Os02t0115900-03

Locus

Os02g0115900

Description

Similar to Endosperm lumenal binding protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsBiP1, BiP1, BiP, Bip3, OsBiP3, BIP1/OsBIP3, OsMed37_2, Med37_2

Oryzabase Gene Name Synonym(s)

ER chaperone BiP1, Binding protein 1, binding protein, endosperm lumenal binding protein, endoplasmic reticulum (ER) chaperone BiP3, Polypeptide chain-binding protein, Mediator 37_2

Transcript Evidence

AK066006 (DDBJ, Best hit)

Protein Evidence

O24182 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: ATP binding (GO:0005524)

Functional domain (InterPro)

Heat shock protein Hsp70 (IPR001023)

Heat shock protein 70 (IPR013126)

Heat shock protein 70, conserved site (IPR018181)

Full-length cDNA

J013044D12 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0115900-03)

RiceXPro (AK066006)

Others

Oryzabase (10082)

KEGG (Os02t0115900-03)

Transcript

1644 bp

>Os02t0115900-03 Similar to Endosperm lumenal binding protein.
TGAGAAGAACATCCTTGTCTTTGACCTTGGTGGTGGGACATTCGATGTCAGTATCTTGAC
CATTGACAACGGTGTGTTTGAGGTGTTGGCCACCAATGGTGACACTCATCTTGGAGGTGA
GGACTTTGACCAGAGAATCATGGAGTACTTCATCAAGTTGATCAAGAAGAAGTACAGCAA
GGACATCAGCAAGGACAACCGTGCTCTTGGAAAGCTGAGGAGGGAAGCTGAGCGTGCCAA
GAGGGCCCTCAGCAACCAGCACCAGGTCCGTGTTGAGATTGAGTCCCTCTTTGACGGGAC
CGATTTCTCGGAGCCGCTGACCCGTGCCAGATTTGAGGAGTTGAACAATGATCTGTTCCG
CAAGACCATGGGACCTGTCAAGAAGGCTATGGACGATGCTGGCCTTGAGAAGAGCCAGAT
TCATGAGATTGTTCTTGTCGGTGGTAGCACCAGGATTCCCAAGGTTCAGCAGCTCCTCAG
AGACTACTTCGAGGGCAAGGAGCCCAACAAGGGTGTCAACCCTGATGAGGCTGTTGCCTA
TGGTGCTGCGGTTCAGGGAAGCATTCTCAGCGGCGAGGGCGGTGACGAAACCAAAGATAT
CCTTCTCCTGGATGTGGCACCCCTTACCCTCGGTATCGAGACTGTCGGTGGAGTCATGAC
CAAGTTGATCCCCAGGAACACCGTCATCCCCACCAAGAAGTCCCAGGTGTTCACCACCTA
CCAGGATCAGCAGACAACCGTCTCCATCCAGGTCTTTGAGGGTGAGCGCAGCATGACCAA
GGACTGCCGTCTTCTCGGCAAGTTCGACCTATCTGGCATTCCAGCAGCACCAAGGGGCAC
CCCCCAGATTGAGGTGACCTTCGAGGTGGACGCCAACGGCATCCTGAACGTGAAGGCTGA
GGACAAGGGCACCGGCAAGTCGGAGAAGATCACGATCACGAACGAGAAGGGGCGCCTGAG
CCAGGAGGAGATCGACCGGATGGTGCGCGAGGCGGAGGAGTTTGCGGAGGAGGACAAGAA
GGTGAAGGAGCGGATCGACGCCCGCAACCAGCTCGAGACCTACGTGTACAACATGAAGAA
CACCGTCGGCGACAAGGACAAGCTGGCGGACAAGCTGGAGAGCGAGGAGAAGGAGAAGGT
GGAGGAGGCCCTCAAGGAGGCCCTCGAGTGGCTGGACGAGAACCAGACCGCCGAGAAGGA
GGAGTACGAGGAGAAGCTCAAGGAGGTCGAGGCCGTCTGCAACCCCATCATCTCCGCCGT
CTACCAGAGGACCGGTGGCGCCCCGGGTGGCGGCGCCGACGGCGAGGGCGGCGTCGACGA
CGAGCATGACGAGCTGTAGATGATGATGATGATGATCTGATTCGATTGATTCAAAGGAGA
CAGCCAATTTTTGTAAGAGATGGCCGGTTACTTTTAGTGGGGTGACTTACTACTACCTTG
GGTTGGGGTTTAGGGGTAGCAAGAGGGGAGAGTTTTATTTGCAGAACACCAGAAAAGAGA
CTAAATCTCTCCTCTTGTTACTTGTGTTGCTCTCTTAGTTTGTTACTCTGTCGAGTGTAG
AACAGCTCTTCCTTTTGCTACTTCCTTCTGATTTCCATGTGAACTGTGAAGAAGAAGAAG
AAACATAAGTAAATTTTAATTACT

CDS

1338 bp

>Os02t0115900-03 Similar to Endosperm lumenal binding protein.
GAGAAGAACATCCTTGTCTTTGACCTTGGTGGTGGGACATTCGATGTCAGTATCTTGACC
ATTGACAACGGTGTGTTTGAGGTGTTGGCCACCAATGGTGACACTCATCTTGGAGGTGAG
GACTTTGACCAGAGAATCATGGAGTACTTCATCAAGTTGATCAAGAAGAAGTACAGCAAG
GACATCAGCAAGGACAACCGTGCTCTTGGAAAGCTGAGGAGGGAAGCTGAGCGTGCCAAG
AGGGCCCTCAGCAACCAGCACCAGGTCCGTGTTGAGATTGAGTCCCTCTTTGACGGGACC
GATTTCTCGGAGCCGCTGACCCGTGCCAGATTTGAGGAGTTGAACAATGATCTGTTCCGC
AAGACCATGGGACCTGTCAAGAAGGCTATGGACGATGCTGGCCTTGAGAAGAGCCAGATT
CATGAGATTGTTCTTGTCGGTGGTAGCACCAGGATTCCCAAGGTTCAGCAGCTCCTCAGA
GACTACTTCGAGGGCAAGGAGCCCAACAAGGGTGTCAACCCTGATGAGGCTGTTGCCTAT
GGTGCTGCGGTTCAGGGAAGCATTCTCAGCGGCGAGGGCGGTGACGAAACCAAAGATATC
CTTCTCCTGGATGTGGCACCCCTTACCCTCGGTATCGAGACTGTCGGTGGAGTCATGACC
AAGTTGATCCCCAGGAACACCGTCATCCCCACCAAGAAGTCCCAGGTGTTCACCACCTAC
CAGGATCAGCAGACAACCGTCTCCATCCAGGTCTTTGAGGGTGAGCGCAGCATGACCAAG
GACTGCCGTCTTCTCGGCAAGTTCGACCTATCTGGCATTCCAGCAGCACCAAGGGGCACC
CCCCAGATTGAGGTGACCTTCGAGGTGGACGCCAACGGCATCCTGAACGTGAAGGCTGAG
GACAAGGGCACCGGCAAGTCGGAGAAGATCACGATCACGAACGAGAAGGGGCGCCTGAGC
CAGGAGGAGATCGACCGGATGGTGCGCGAGGCGGAGGAGTTTGCGGAGGAGGACAAGAAG
GTGAAGGAGCGGATCGACGCCCGCAACCAGCTCGAGACCTACGTGTACAACATGAAGAAC
ACCGTCGGCGACAAGGACAAGCTGGCGGACAAGCTGGAGAGCGAGGAGAAGGAGAAGGTG
GAGGAGGCCCTCAAGGAGGCCCTCGAGTGGCTGGACGAGAACCAGACCGCCGAGAAGGAG
GAGTACGAGGAGAAGCTCAAGGAGGTCGAGGCCGTCTGCAACCCCATCATCTCCGCCGTC
TACCAGAGGACCGGTGGCGCCCCGGGTGGCGGCGCCGACGGCGAGGGCGGCGTCGACGAC
GAGCATGACGAGCTGTAG

Protein

446 aa

>Os02t0115900-03 Similar to Endosperm lumenal binding protein.
EKNILVFDLGGGTFDVSILTIDNGVFEVLATNGDTHLGGEDFDQRIMEYFIKLIKKKYSK
DISKDNRALGKLRREAERAKRALSNQHQVRVEIESLFDGTDFSEPLTRARFEELNNDLFR
KTMGPVKKAMDDAGLEKSQIHEIVLVGGSTRIPKVQQLLRDYFEGKEPNKGVNPDEAVAY
GAAVQGSILSGEGGDETKDILLLDVAPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFTTY
QDQQTTVSIQVFEGERSMTKDCRLLGKFDLSGIPAAPRGTPQIEVTFEVDANGILNVKAE
DKGTGKSEKITITNEKGRLSQEEIDRMVREAEEFAEEDKKVKERIDARNQLETYVYNMKN
TVGDKDKLADKLESEEKEKVEEALKEALEWLDENQTAEKEEYEEKLKEVEAVCNPIISAV
YQRTGGAPGGGADGEGGVDDEHDEL*

5'UTR

chr02:840970..840970 (- strand) : 1 bp

CDS

chr02:840855..840969 (- strand) : 115 bp

chr02:840078..840557 (- strand) : 480 bp

chr02:839828..839982 (- strand) : 155 bp

chr02:839638..839720 (- strand) : 83 bp

chr02:839048..839552 (- strand) : 505 bp

3'UTR

chr02:838743..839047 (- strand) : 305 bp

FASTA

>Os02t0115900-03 class=Sequence position=chr02:838743..840970 (- strand)
TGAGAAGAAC ATCCTTGTCT TTGACCTTGG TGGTGGGACA TTCGATGTCA GTATCTTGAC CATTGACAAC GGTGTGTTTG
AGGTGTTGGC CACCAATGGT GACACTCATC TTGGAGGTAT GACTGCTTTT ATTTGCCCTT AGGTACTAAA TATCTGCTTC
TGTACAACAT CACAGTTGTA GAGTACTGTA GTTTGATTCA ATGATTTTCA TGCAACACAT CATGGTAAAT TGGTTATCTT
ATACCTGCAC ATTCTCATTA GACTTTTCAG TAAAGGCACG CTGTCTTTTA GAAGATTGGC ACTATTCATT TGCTTTTAAA
CTAATGACAT GCCTTTTGTA GTTAGTTGGT CGTCTTGATT ATCTGGATAG TGCACTGTGA TTCATATTTG ACTGAACTGT
CTCATCTCTT CAGGTGAGGA CTTTGACCAG AGAATCATGG AGTACTTCAT CAAGTTGATC AAGAAGAAGT ACAGCAAGGA
CATCAGCAAG GACAACCGTG CTCTTGGAAA GCTGAGGAGG GAAGCTGAGC GTGCCAAGAG GGCCCTCAGC AACCAGCACC
AGGTCCGTGT TGAGATTGAG TCCCTCTTTG ACGGGACCGA TTTCTCGGAG CCGCTGACCC GTGCCAGATT TGAGGAGTTG
AACAATGATC TGTTCCGCAA GACCATGGGA CCTGTCAAGA AGGCTATGGA CGATGCTGGC CTTGAGAAGA GCCAGATTCA
TGAGATTGTT CTTGTCGGTG GTAGCACCAG GATTCCCAAG GTTCAGCAGC TCCTCAGAGA CTACTTCGAG GGCAAGGAGC
CCAACAAGGG TGTCAACCCT GATGAGGCTG TTGCCTATGG TGCTGCGGTT CAGGGAAGCA TTCTCAGCGG CGAGGGCGGT
GACGAAACCA AAGGTTCGAC CTTGATCACA TACATAGTCC TTTGGGTTGG TAACAACTGC GATCATCTGT CTTGCATATA
CTTATCGTGC TTTGATTTTG GTACGCAGAT ATCCTTCTCC TGGATGTGGC ACCCCTTACC CTCGGTATCG AGACTGTCGG
TGGAGTCATG ACCAAGTTGA TCCCCAGGAA CACCGTCATC CCCACCAAGA AGTCCCAGGT GTTCACCACC TACCAGGATC
AGCAGACAAC CGTCTCCATC CAGGTAACAG ACATAAGCAA ACTTTCTTCT TTGAGTCCTG ACATTACATC CTGGTCAGAA
AATTTCAGCT CAGACCACCT AACGCCTCTG AATCTCGCCT TGTGGTGTAG GTCTTTGAGG GTGAGCGCAG CATGACCAAG
GACTGCCGTC TTCTCGGCAA GTTCGACCTA TCTGGCATTC CAGCAGCACC AAGGTTTGCT CATGTCCAGA AAAAAATGTT
AGCTTACTCA AATGGATAAA TGAATCCAGC GCCTGATATC TGTTGGTTAA ACTTGCAGGG GCACCCCCCA GATTGAGGTG
ACCTTCGAGG TGGACGCCAA CGGCATCCTG AACGTGAAGG CTGAGGACAA GGGCACCGGC AAGTCGGAGA AGATCACGAT
CACGAACGAG AAGGGGCGCC TGAGCCAGGA GGAGATCGAC CGGATGGTGC GCGAGGCGGA GGAGTTTGCG GAGGAGGACA
AGAAGGTGAA GGAGCGGATC GACGCCCGCA ACCAGCTCGA GACCTACGTG TACAACATGA AGAACACCGT CGGCGACAAG
GACAAGCTGG CGGACAAGCT GGAGAGCGAG GAGAAGGAGA AGGTGGAGGA GGCCCTCAAG GAGGCCCTCG AGTGGCTGGA
CGAGAACCAG ACCGCCGAGA AGGAGGAGTA CGAGGAGAAG CTCAAGGAGG TCGAGGCCGT CTGCAACCCC ATCATCTCCG
CCGTCTACCA GAGGACCGGT GGCGCCCCGG GTGGCGGCGC CGACGGCGAG GGCGGCGTCG ACGACGAGCA TGACGAGCTG
TAGATGATGA TGATGATGAT CTGATTCGAT TGATTCAAAG GAGACAGCCA ATTTTTGTAA GAGATGGCCG GTTACTTTTA
GTGGGGTGAC TTACTACTAC CTTGGGTTGG GGTTTAGGGG TAGCAAGAGG GGAGAGTTTT ATTTGCAGAA CACCAGAAAA
GAGACTAAAT CTCTCCTCTT GTTACTTGTG TTGCTCTCTT AGTTTGTTAC TCTGTCGAGT GTAGAACAGC TCTTCCTTTT
GCTACTTCCT TCTGATTTCC ATGTGAACTG TGAAGAAGAA GAAGAAACAT AAGTAAATTT TAATTACT

Locus: Os02g0115900

Loading...

Locus: Os02g0115900

Loading...