Os02t0116300-01

Locus

Os02g0116300

Description

Similar to Yellow stripe-like transporter 17.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

YSL7

CGSNL Gene Name

YELLOW STRIP-LIKE GENE 7

Oryzabase Gene Symbol Synonym(s)

OsYSL7, OsYs4

Oryzabase Gene Name Synonym(s)

rice YSL (yellow stripe-like) gene 7, Probable metal-nicotianamine transporter YSL7, Protein YELLOW STRIPE LIKE 7, yellow stripe 1-like transporter 7

Transcript Evidence

AK070691 (DDBJ, Best hit)

AK100087 (DDBJ, Best hit)

Protein Evidence

B8A2G4 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: transmembrane transport (GO:0055085)

Functional domain (InterPro)

Oligopeptide transporter OPT superfamily (IPR004813)

Full-length cDNA

J023058J05 (Online Clone Ordering)

J023003B17 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0116300-01)

Others

Oryzabase (8365)

Transcript

2339 bp

>Os02t0116300-01 Similar to Yellow stripe-like transporter 17.
TTGCTGCCAGCATTTTGATTCTGTGTGTGTGTCTTGGTTGCAAAAACCAAGACATACACA
CAGAATCAAATAATAACAAAGGTTTCCTAGCCTCAAAGGATACATATATATAGTTTCCCT
ACAATACAATGGAGCCTGTCAATGATTTCCAGGAAGGCATTTCAACAGAGCATGCCTTTG
AGGCAGAGCCTGTGCCATCATTGTCGGAAACAATAACGCCACGATCAATGGTGGTGAGCT
TCATCCTTAGTGTAACTCTCAGCATCGTCGCCATGAAGGTCACCTTGAGCTCTGGCTTCA
TTCCGTCGTTCAGCATCCCAGCCGGCCTCCTCGGTTTTTGTGTATCCCGTGCGTCGATCC
GCATTCTTGACTACTTCGCAGTGGCACAACTACCATTCACACGCCAAGAGAACACCATCA
TCCAGACCTGTGTCGTCGCATGCACCTCGATCACATTCACCGGTGGCTTTGGGACATATA
TTCTTGCAATGGGAAAGAAAGCAGCTGTAGGGGATGTCAATGCCCAAAATAACGTTGAGG
AGCCAAGCTTTGCCAGGATGATCACCTTCCTCTTCCTTATCAGCTTTGCTGGCATGTTCA
TCATCATGCCCTTCAGGAAGGTCATGATCATTAGGCACCGGTTGACATTCCCCAGCGGCA
CAGCAACGGCGCACCTCATCAATAGCTTCCATACACCTCAAGGTGTCAAGCAAGCAAGGA
AGCAAGTGACATTATTGTTTAAATCGTTTGGAGGAACCATCGCATGGTCGCTCTTCCAGT
GGTTCTTCGCCTCTGGGCCGGGCTGTGGCTTCAAATTCTTCCCCACATTTGGCCTCGAGG
CATATAAACACGGATTCTTCTTCGATTTCACCATGGCCAATGTCGGCATTGGCATGATGT
GCCCGTACATGATCGTGTTCTCCGTTTTCATTGGCACCATCATCTCGTGCGGTGTAATTT
GGCCGTACATCGAGTCAAAGGAGGGCATCTGGTACCCAAGCAACCTTGGGCCCAACAGCC
TTAACGGCATCAGAGGTTACAAGGTGTTCATCGGCTTGTCCATGATAATGGCTGACTGCC
TCTTCGTCTTCCTCTGCATCATGGTCCGGACAACATGTGCCATGATCAAGCGGCGTCGGC
AGGCAATGCAAGGTGGTGGCGGTAATGCGCAGCCATTCCAGGGTATCGACATCGccgatc
agccggtgaagagcttcgatgatcgccgcagggcgcaggtgttcctccgggacgagatac
cggactcggtcaccattggctgctatgtcctcctgtcgatcatctccatcgccgccatcc
ctcacctctacccacagatgaggtacagccatgttgcgctcatctacctcgccgcgcccg
tcttcgccttctgcaacgcctacggcttcggcgtcaccgacatgaacctggctagcacct
attgcaagatcgccatgttcgcgttcggctcgtgggtcggcatcaagagcggcggcgtgg
tcgccgccctggtcgccggcgggatcaccatgtcgatcctgggcaacgcggccgacgtcg
cgcaggacctcaagacgggctacctgacgctgacgtcgccgcgcgccgtgttcatcagcg
aggcgatcggcacggcgctgggatgcgtcgtcaaccccaccgtgttctgggtgttctaca
gggtgtacaagatgggcagcggcgacatgggcgacatgccctACGCCAAGCTCTACCGCG
GCTTCGCCATGCTCAGCGTCGGCGACGGCGAGCAAGGCCTGCCCAGGCACAGCATGCTCC
TCTTCAAGGTCTTCTTCGTGCTCGCCCTGGCGCTCAGCGTGTTCCGGGAGGTGGCGAGCC
GGAAGGAGTGGCGCATCCGGCGCTACATCCCgagcaccatcggcatggccatcaccttct
tcatgccgccgCGCGTGCCCGTCGGCATGTGCATCGGCAGCCTGGTGGCGTACCTGTGGG
AGAAGATGGACGCCGGCCGCGGGCGGATGCTCTCGCCGGCGCTGGCGTCGGGGCTCATCT
GCGGCGACGGCGTCGGCTCGATCTTGCTGTCCATGCTGACACTCATGGGTGCCAGGGCGC
CCATCTGCATCAAGTTCTTGTCTCGAGGTGACAATGTCAAGTTGGACGCCTTCTTGGCAA
CACTCCATGACATGAGATAGCTACTAGCTAGCTATCCATGTAGGGAAACTAGATCATTTT
CTCAGGTGTCAAAACTTTTGTACATATGTATCCACGTCATAGGGGCTTGAGTTAGGAGTC
GTGGCAAACTGTATAATCAAGTTTCAGTTCAGTCTATAAACACAGTTTGATCTCCTCTA

CDS

2067 bp

>Os02t0116300-01 Similar to Yellow stripe-like transporter 17.
TTTCCCTACAATACAATGGAGCCTGTCAATGATTTCCAGGAAGGCATTTCAACAGAGCAT
GCCTTTGAGGCAGAGCCTGTGCCATCATTGTCGGAAACAATAACGCCACGATCAATGGTG
GTGAGCTTCATCCTTAGTGTAACTCTCAGCATCGTCGCCATGAAGGTCACCTTGAGCTCT
GGCTTCATTCCGTCGTTCAGCATCCCAGCCGGCCTCCTCGGTTTTTGTGTATCCCGTGCG
TCGATCCGCATTCTTGACTACTTCGCAGTGGCACAACTACCATTCACACGCCAAGAGAAC
ACCATCATCCAGACCTGTGTCGTCGCATGCACCTCGATCACATTCACCGGTGGCTTTGGG
ACATATATTCTTGCAATGGGAAAGAAAGCAGCTGTAGGGGATGTCAATGCCCAAAATAAC
GTTGAGGAGCCAAGCTTTGCCAGGATGATCACCTTCCTCTTCCTTATCAGCTTTGCTGGC
ATGTTCATCATCATGCCCTTCAGGAAGGTCATGATCATTAGGCACCGGTTGACATTCCCC
AGCGGCACAGCAACGGCGCACCTCATCAATAGCTTCCATACACCTCAAGGTGTCAAGCAA
GCAAGGAAGCAAGTGACATTATTGTTTAAATCGTTTGGAGGAACCATCGCATGGTCGCTC
TTCCAGTGGTTCTTCGCCTCTGGGCCGGGCTGTGGCTTCAAATTCTTCCCCACATTTGGC
CTCGAGGCATATAAACACGGATTCTTCTTCGATTTCACCATGGCCAATGTCGGCATTGGC
ATGATGTGCCCGTACATGATCGTGTTCTCCGTTTTCATTGGCACCATCATCTCGTGCGGT
GTAATTTGGCCGTACATCGAGTCAAAGGAGGGCATCTGGTACCCAAGCAACCTTGGGCCC
AACAGCCTTAACGGCATCAGAGGTTACAAGGTGTTCATCGGCTTGTCCATGATAATGGCT
GACTGCCTCTTCGTCTTCCTCTGCATCATGGTCCGGACAACATGTGCCATGATCAAGCGG
CGTCGGCAGGCAATGCAAGGTGGTGGCGGTAATGCGCAGCCATTCCAGGGTATCGACATC
Gccgatcagccggtgaagagcttcgatgatcgccgcagggcgcaggtgttcctccgggac
gagataccggactcggtcaccattggctgctatgtcctcctgtcgatcatctccatcgcc
gccatccctcacctctacccacagatgaggtacagccatgttgcgctcatctacctcgcc
gcgcccgtcttcgccttctgcaacgcctacggcttcggcgtcaccgacatgaacctggct
agcacctattgcaagatcgccatgttcgcgttcggctcgtgggtcggcatcaagagcggc
ggcgtggtcgccgccctggtcgccggcgggatcaccatgtcgatcctgggcaacgcggcc
gacgtcgcgcaggacctcaagacgggctacctgacgctgacgtcgccgcgcgccgtgttc
atcagcgaggcgatcggcacggcgctgggatgcgtcgtcaaccccaccgtgttctgggtg
ttctacagggtgtacaagatgggcagcggcgacatgggcgacatgccctACGCCAAGCTC
TACCGCGGCTTCGCCATGCTCAGCGTCGGCGACGGCGAGCAAGGCCTGCCCAGGCACAGC
ATGCTCCTCTTCAAGGTCTTCTTCGTGCTCGCCCTGGCGCTCAGCGTGTTCCGGGAGGTG
GCGAGCCGGAAGGAGTGGCGCATCCGGCGCTACATCCCgagcaccatcggcatggccatc
accttcttcatgccgccgCGCGTGCCCGTCGGCATGTGCATCGGCAGCCTGGTGGCGTAC
CTGTGGGAGAAGATGGACGCCGGCCGCGGGCGGATGCTCTCGCCGGCGCTGGCGTCGGGG
CTCATCTGCGGCGACGGCGTCGGCTCGATCTTGCTGTCCATGCTGACACTCATGGGTGCC
AGGGCGCCCATCTGCATCAAGTTCTTGTCTCGAGGTGACAATGTCAAGTTGGACGCCTTC
TTGGCAACACTCCATGACATGAGATAG

Protein

689 aa

>Os02t0116300-01 Similar to Yellow stripe-like transporter 17.
FPYNTMEPVNDFQEGISTEHAFEAEPVPSLSETITPRSMVVSFILSVTLSIVAMKVTLSS
GFIPSFSIPAGLLGFCVSRASIRILDYFAVAQLPFTRQENTIIQTCVVACTSITFTGGFG
TYILAMGKKAAVGDVNAQNNVEEPSFARMITFLFLISFAGMFIIMPFRKVMIIRHRLTFP
SGTATAHLINSFHTPQGVKQARKQVTLLFKSFGGTIAWSLFQWFFASGPGCGFKFFPTFG
LEAYKHGFFFDFTMANVGIGMMCPYMIVFSVFIGTIISCGVIWPYIESKEGIWYPSNLGP
NSLNGIRGYKVFIGLSMIMADCLFVFLCIMVRTTCAMIKRRRQAMQGGGGNAQPFQGIDI
ADQPVKSFDDRRRAQVFLRDEIPDSVTIGCYVLLSIISIAAIPHLYPQMRYSHVALIYLA
APVFAFCNAYGFGVTDMNLASTYCKIAMFAFGSWVGIKSGGVVAALVAGGITMSILGNAA
DVAQDLKTGYLTLTSPRAVFISEAIGTALGCVVNPTVFWVFYRVYKMGSGDMGDMPYAKL
YRGFAMLSVGDGEQGLPRHSMLLFKVFFVLALALSVFREVASRKEWRIRRYIPSTIGMAI
TFFMPPRVPVGMCIGSLVAYLWEKMDAGRGRMLSPALASGLICGDGVGSILLSMLTLMGA
RAPICIKFLSRGDNVKLDAFLATLHDMR*

5'UTR

chr02:862273..862385 (+ strand) : 113 bp

CDS

chr02:862386..862734 (+ strand) : 349 bp

chr02:862823..863078 (+ strand) : 256 bp

chr02:863177..863311 (+ strand) : 135 bp

chr02:863395..864721 (+ strand) : 1327 bp

3'UTR

chr02:864722..864880 (+ strand) : 159 bp

FASTA

>Os02t0116300-01 class=Sequence position=chr02:862273..864880 (+ strand)
TTGCTGCCAG CATTTTGATT CTGTGTGTGT GTCTTGGTTG CAAAAACCAA GACATACACA CAGAATCAAA TAATAACAAA
GGTTTCCTAG CCTCAAAGGA TACATATATA TAGTTTCCCT ACAATACAAT GGAGCCTGTC AATGATTTCC AGGAAGGCAT
TTCAACAGAG CATGCCTTTG AGGCAGAGCC TGTGCCATCA TTGTCGGAAA CAATAACGCC ACGATCAATG GTGGTGAGCT
TCATCCTTAG TGTAACTCTC AGCATCGTCG CCATGAAGGT CACCTTGAGC TCTGGCTTCA TTCCGTCGTT CAGCATCCCA
GCCGGCCTCC TCGGTTTTTG TGTATCCCGT GCGTCGATCC GCATTCTTGA CTACTTCGCA GTGGCACAAC TACCATTCAC
ACGCCAAGAG AACACCATCA TCCAGACCTG TGTCGTCGCA TGCACCTCGA TCACATTCAC CGGTATATAG ACAATCTGAA
AATAGTAGTT GATAGAATTG TGTGCACTAT TTTATGTTTA TCTTTACTAT AACCGTACTT CCTTACATAG GTGGCTTTGG
GACATATATT CTTGCAATGG GAAAGAAAGC AGCTGTAGGG GATGTCAATG CCCAAAATAA CGTTGAGGAG CCAAGCTTTG
CCAGGATGAT CACCTTCCTC TTCCTTATCA GCTTTGCTGG CATGTTCATC ATCATGCCCT TCAGGAAGGT CATGATCATT
AGGCACCGGT TGACATTCCC CAGCGGCACA GCAACGGCGC ACCTCATCAA TAGCTTCCAT ACACCTCAAG GTGTCAAGCA
AGCAAGGTAT CATCAATTAA ACTTTACATG GAAATGTTTC TGTTGGATCA AGTACTATTC GAAGCCTTAG ATTACACAAT
CAAATTGACT ATTTGTGTTT GCAGGAAGCA AGTGACATTA TTGTTTAAAT CGTTTGGAGG AACCATCGCA TGGTCGCTCT
TCCAGTGGTT CTTCGCCTCT GGGCCGGGCT GTGGCTTCAA ATTCTTCCCC ACATTTGGCC TCGAGGCATA TAAACACGGG
TACGCAATCA GACATGCATG GATGGAATTC ATCAGCTAGC GTAGTGGTTG ATTGGGAAAC TAATTTTGTT CCCTTTTATC
AGATTCTTCT TCGATTTCAC CATGGCCAAT GTCGGCATTG GCATGATGTG CCCGTACATG ATCGTGTTCT CCGTTTTCAT
TGGCACCATC ATCTCGTGCG GTGTAATTTG GCCGTACATC GAGTCAAAGG AGGGCATCTG GTACCCAAGC AACCTTGGGC
CCAACAGCCT TAACGGCATC AGAGGTTACA AGGTGTTCAT CGGCTTGTCC ATGATAATGG CTGACTGCCT CTTCGTCTTC
CTCTGCATCA TGGTCCGGAC AACATGTGCC ATGATCAAGC GGCGTCGGCA GGCAATGCAA GGTGGTGGCG GTAATGCGCA
GCCATTCCAG GGTATCGACA TCGccgatca gccggtgaag agcttcgatg atcgccgcag ggcgcaggtg ttcctccggg
acgagatacc ggactcggtc accattggct gctatgtcct cctgtcgatc atctccatcg ccgccatccc tcacctctac
ccacagatga ggtacagcca tgttgcgctc atctacctcg ccgcgcccgt cttcgccttc tgcaacgcct acggcttcgg
cgtcaccgac atgaacctgg ctagcaccta ttgcaagatc gccatgttcg cgttcggctc gtgggtcggc atcaagagcg
gcggcgtggt cgccgccctg gtcgccggcg ggatcaccat gtcgatcctg ggcaacgcgg ccgacgtcgc gcaggacctc
aagacgggct acctgacgct gacgtcgccg cgcgccgtgt tcatcagcga ggcgatcggc acggcgctgg gatgcgtcgt
caaccccacc gtgttctggg tgttctacag ggtgtacaag atgggcagcg gcgacatggg cgacatgccc tACGCCAAGC
TCTACCGCGG CTTCGCCATG CTCAGCGTCG GCGACGGCGA GCAAGGCCTG CCCAGGCACA GCATGCTCCT CTTCAAGGTC
TTCTTCGTGC TCGCCCTGGC GCTCAGCGTG TTCCGGGAGG TGGCGAGCCG GAAGGAGTGG CGCATCCGGC GCTACATCCC
gagcaccatc ggcatggcca tcaccttctt catgccgccg CGCGTGCCCG TCGGCATGTG CATCGGCAGC CTGGTGGCGT
ACCTGTGGGA GAAGATGGAC GCCGGCCGCG GGCGGATGCT CTCGCCGGCG CTGGCGTCGG GGCTCATCTG CGGCGACGGC
GTCGGCTCGA TCTTGCTGTC CATGCTGACA CTCATGGGTG CCAGGGCGCC CATCTGCATC AAGTTCTTGT CTCGAGGTGA
CAATGTCAAG TTGGACGCCT TCTTGGCAAC ACTCCATGAC ATGAGATAGC TACTAGCTAG CTATCCATGT AGGGAAACTA
GATCATTTTC TCAGGTGTCA AAACTTTTGT ACATATGTAT CCACGTCATA GGGGCTTGAG TTAGGAGTCG TGGCAAACTG
TATAATCAAG TTTCAGTTCA GTCTATAAAC ACAGTTTGAT CTCCTCTA