Os02t0117500-01

Locus

Os02g0117500

Description

Similar to Glutamate receptor 3.3 precursor (Ligand-gated ion channel 3.3).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsGLR3.1, GLR3.1, OsGLR3.2, GLR3.2

Oryzabase Gene Name Synonym(s)

Glutamate receptor homolog 3.1, GLUTAMATE RECEPTOR-LIKE 3.2

Transcript Evidence

AK068706 (DDBJ, Best hit)

Protein Evidence

B8AGI2 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: transport (GO:0006810)

Biological Process: G-protein coupled receptor protein signaling pathway (GO:0007186)

Cellular Component: membrane (GO:0016020)

Cellular Component: integral to membrane (GO:0016021)

Cellular Component: outer membrane-bounded periplasmic space (GO:0030288)

Molecular Function: GABA-B receptor activity (GO:0004965)

Molecular Function: ionotropic glutamate receptor activity (GO:0004970)

Molecular Function: transporter activity (GO:0005215)

Molecular Function: extracellular-glutamate-gated ion channel activity (GO:0005234)

Functional domain (InterPro)

Ionotropic glutamate receptor (IPR001320)

Extracellular solute-binding protein, family 3 (IPR001638)

Extracellular ligand-binding receptor (IPR001828)

GPCR, family 3, gamma-aminobutyric acid receptor, type B (IPR002455)

Ionotropic glutamate receptor, plant (IPR017103)

Full-length cDNA

J013158O16 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0117500-01)

RiceXPro (AK068706)

Others

Oryzabase (15498)

KEGG (Os02t0117500-01)

Transcript

3321 bp

>Os02t0117500-01 Similar to Glutamate receptor 3.3 precursor (Ligand-gated ion channel 3.3).
ACCAGAAAATGTGCTGAAAATGAGCTTCGCGAAAGCTCACGCGGTCTTCTTCAGAGAGAG
GGGTCCCTACTCCGTGTCGAGCTGAGCAGCAGCAGCAGCAGCAGCCCGCGAGCCCAAAGA
TTTCCTCTTTCGTGGGGGAGACACGCCAAATCCAATCCGAGTTCTCCAACTCATCAATAA
TCTGCAAGATGTGAATAAGTCTCAAGTAGACTTTGCACCATTTGAGACACAATGAAGATA
GGTCTGCTCATGTTGCTTGTTCTCTTCCTGGTCATGTCCCCTGATGGGATCCGCAGGAGC
TTAGCCGCGAGGCCTTCTATTGTGAATATTGGGGCCATTCTTCGATTTAACTCCACCATT
GGAGGTGTTTCGATGATTGCTATCCAGGCAGCCTTGGAGGATATTAATTCTGATTCAACA
ATTCTAAATGGAACAACTTTAAAAGTTGACATGAGGGATACAAATTGTGATGATGGTTTC
CTTGGGATGGTTGAAGCTTTGCAGTTCATGGAGACTGATGTGATTGCAATTATTGGCCCA
CAGTGCTCAACAATTGCACATATCGTTTCATATGTAGCAAATGAGCTCCGAGTCCCTCTT
ATGTCCTTTGCATCTGATGCAACTTTGTCATCAATTCAGTTCCCATTCTTTGTTCGAACT
GCTCCCAGTGATCTCTATCAAATGGATGCTGTAGCTGCAATAGTTGACTACTACCGTTGG
AAGATAGTGACTGCTATATATATTGATGATGATTATGGCCGAAATGGAATAGCCACATTG
GATGATGCACTTACTCAAAGGCGCTGCAAAATCTCCTACAAGATTGCATTTCCTGCAAAT
GCTAGAAAGAGCGACCTCATAAATTTATTGGTCAGCGTTAGTTATATGGAGTCTCGTGTT
ATCATCCTCCATACTGGTGCTGGACCTGGACTCAAGATTTTCTCTCTGGCGAACCAACTA
AGCATGATGGGCAATGGCTATGTATGGATTGCAACTGATTGGCTTTCTGCTTATCTCGAT
GCTAATTCATCGGTTCCTGATGAGACTATGTATGGCATGCAAGGAGTTCTCACTTTACGC
CCACACATTCCTGAATCAAAGATGAAGAGTAATTTGATCTCCAAGTGGAGCAGGTTAAGC
AAGAAGTACAGTTATAGTTATCTCCGCACAAGTTCATATGCTTTTTATGTTTATGATAGT
GTATGGGCAGTAGCTCGGGCTTTGGATGCTTTCTTTGATGATGGTGGGAAGATTTCCTTT
TCAAATGATTCAAGGCTGCGTGATGAAACTGGAGGTACTCTTCACCTTGAAGCAATGAGT
ATTTTTGATATGGGAAATAACTTGTTGGAGAAGATTAGAAAGGCAAACTTCACTGGGGTG
TCTGGGCAAGTGCAATTTGATGCTACTGGTGACCTCATTCATCCTGCTTATGATGTCATA
AATATAATTGGAAATGGCATGCGGACAGTTGGCTATTGGTCAAATTATTCTAGCTTGCTG
TCGACTGTCCTTCCGGAGGTTCTCTATTCAGAGCCTCCTAACAATTCTCTAGCTAATCAA
CATCTATATGATGTTATTTGGCCTGGGCAGACTGCACAAACGCCTCGAGGCTGGGTTTTT
CCTTCTAATGCTAAGGAGTTGAAAATTGGTGTCCCCAACAGATTTAGCTTCAGAGAATTT
GTCACAAAAGATAATGTTACTGGATCAATGAAGGGCTATTGCATTGATGTCTTTACTCAG
GCATTGGCTTTGCTTCCTTATCCTGTTACATACAAGTTTATACCATTTGGGGGTGGTAAT
GAAAATCCACATTATGACAAACTCGTACAAATGGTTGAGGATAACGAGTTTGACGCAGCA
ATAGGGGATATTGCAATTACAATGAGCAGGACTGTAACTACTGATTTCACCCAGCCCTTC
ATTGAATCTGGCTTGGTTATCTTGGCTCCAGTTAAAAAACATATTGTTAATTCCTGGGCA
TTCTTGCAGCCATTCACTCTTCAGATGTGGTGTGTTACTGGATTATTCTTTCTTGTTGTG
GGTGCAGTTGTTTGGGTTCTTGAACATCGAATAAATGACGAATTCCGTGGCTCACCGCGA
GAACAAATAATTACTATTTTCTGGTTCAGCTTTTCAACCTTGTTTTTTGCACACAGAGAA
AATACCATGAGTACCTTAGGACGTGGTGTCTTGATCATATGGCTATTTGTTGTTTTAATC
ATTCAATCCAGCTATACTGCAAGTCTTACTTCCATCCTGACTGTTCAACAACTCGATACT
TCTATAAGAGGAATTGATGACCTGAAAAATAGTGATGGTCCTATTGGTTTCCAAGTTGGT
TCTTTTGCAGAAGAATACATGGTCAGGGAGCTGAACATCTCACGGTCGAGGCTGAGAGCT
CTTGGTTCTCCAGAAGAATACGCTGAAGCGCTTAAGCATGGCCCTAAGAGAGGAGGTGTC
ATGGCCATTGTAGATGAGCGCCCCTACGTTGAACTGTTTTTGTCAACTTATTGCAAGATT
GCAGTTGCTGGTTCGGATTTCACCAGCAGAGGATGGGGCTTTGCATTTCCAAGAGACTCC
CCTTTGCAAATTGACCTATCGACTGCGATCCTGTCACTGTCGGAGAACGGGGAACTGCAG
AGGATCCATGACAAATGGCTCAAGACTAGCGAGTGCTCAGCCGACAACACCGAGTTTGTC
GACTCGGATCAGCTCCGCCTTGAGAGCTTCTGGGGCCTGTTCCTCATTTGTGGTATCGCA
TGTGTCATCGCGCTGCTCATCTACTTTTTCACCACCGTACGCAAATTCCTCAGGCATGAA
CCTCCAGAAGATCCAACACCTCGTCCAGGCGGATCAACAACTCTTCCAGACGAACGAACA
CCCCCAAAGAACGGACAAGAGAAATGCAACTGCAGAAATTTCATCTCATTTCTTGATCAC
AAGGAGCCACCAAAGAAGAAGCGGTCCTTGAGTTTGACGCCGACAACGCCATTGAGCAAC
TTTACTGCCCTTGAAATAGAAGGACCTGTGAGGACAGTCAGGAATGGTAGTGTCGTTGAC
ATATAGAACTAGTGTGTGTAAAAAGCTGAGATGTTATATATTTTGGATCTGAGATATGCC
ATCTTTCGGTCAATCTCCTCAATTTTAGTTGAGAGAAAATATAATCAGAGGCTGCATAAG
ATGCTATCTGTAGATTTCAAGCAAATCCGGTGATGGGAAAAATTCATTTGAGGCCAGTTT
GGCAACTGAAAAACTGTATAGAAAGTTATTCTTGTCCTTGATGGTATTTTGAATGGAGGA
AATATATACGTCTGTTTGATT

CDS

2835 bp

>Os02t0117500-01 Similar to Glutamate receptor 3.3 precursor (Ligand-gated ion channel 3.3).
ATGAAGATAGGTCTGCTCATGTTGCTTGTTCTCTTCCTGGTCATGTCCCCTGATGGGATC
CGCAGGAGCTTAGCCGCGAGGCCTTCTATTGTGAATATTGGGGCCATTCTTCGATTTAAC
TCCACCATTGGAGGTGTTTCGATGATTGCTATCCAGGCAGCCTTGGAGGATATTAATTCT
GATTCAACAATTCTAAATGGAACAACTTTAAAAGTTGACATGAGGGATACAAATTGTGAT
GATGGTTTCCTTGGGATGGTTGAAGCTTTGCAGTTCATGGAGACTGATGTGATTGCAATT
ATTGGCCCACAGTGCTCAACAATTGCACATATCGTTTCATATGTAGCAAATGAGCTCCGA
GTCCCTCTTATGTCCTTTGCATCTGATGCAACTTTGTCATCAATTCAGTTCCCATTCTTT
GTTCGAACTGCTCCCAGTGATCTCTATCAAATGGATGCTGTAGCTGCAATAGTTGACTAC
TACCGTTGGAAGATAGTGACTGCTATATATATTGATGATGATTATGGCCGAAATGGAATA
GCCACATTGGATGATGCACTTACTCAAAGGCGCTGCAAAATCTCCTACAAGATTGCATTT
CCTGCAAATGCTAGAAAGAGCGACCTCATAAATTTATTGGTCAGCGTTAGTTATATGGAG
TCTCGTGTTATCATCCTCCATACTGGTGCTGGACCTGGACTCAAGATTTTCTCTCTGGCG
AACCAACTAAGCATGATGGGCAATGGCTATGTATGGATTGCAACTGATTGGCTTTCTGCT
TATCTCGATGCTAATTCATCGGTTCCTGATGAGACTATGTATGGCATGCAAGGAGTTCTC
ACTTTACGCCCACACATTCCTGAATCAAAGATGAAGAGTAATTTGATCTCCAAGTGGAGC
AGGTTAAGCAAGAAGTACAGTTATAGTTATCTCCGCACAAGTTCATATGCTTTTTATGTT
TATGATAGTGTATGGGCAGTAGCTCGGGCTTTGGATGCTTTCTTTGATGATGGTGGGAAG
ATTTCCTTTTCAAATGATTCAAGGCTGCGTGATGAAACTGGAGGTACTCTTCACCTTGAA
GCAATGAGTATTTTTGATATGGGAAATAACTTGTTGGAGAAGATTAGAAAGGCAAACTTC
ACTGGGGTGTCTGGGCAAGTGCAATTTGATGCTACTGGTGACCTCATTCATCCTGCTTAT
GATGTCATAAATATAATTGGAAATGGCATGCGGACAGTTGGCTATTGGTCAAATTATTCT
AGCTTGCTGTCGACTGTCCTTCCGGAGGTTCTCTATTCAGAGCCTCCTAACAATTCTCTA
GCTAATCAACATCTATATGATGTTATTTGGCCTGGGCAGACTGCACAAACGCCTCGAGGC
TGGGTTTTTCCTTCTAATGCTAAGGAGTTGAAAATTGGTGTCCCCAACAGATTTAGCTTC
AGAGAATTTGTCACAAAAGATAATGTTACTGGATCAATGAAGGGCTATTGCATTGATGTC
TTTACTCAGGCATTGGCTTTGCTTCCTTATCCTGTTACATACAAGTTTATACCATTTGGG
GGTGGTAATGAAAATCCACATTATGACAAACTCGTACAAATGGTTGAGGATAACGAGTTT
GACGCAGCAATAGGGGATATTGCAATTACAATGAGCAGGACTGTAACTACTGATTTCACC
CAGCCCTTCATTGAATCTGGCTTGGTTATCTTGGCTCCAGTTAAAAAACATATTGTTAAT
TCCTGGGCATTCTTGCAGCCATTCACTCTTCAGATGTGGTGTGTTACTGGATTATTCTTT
CTTGTTGTGGGTGCAGTTGTTTGGGTTCTTGAACATCGAATAAATGACGAATTCCGTGGC
TCACCGCGAGAACAAATAATTACTATTTTCTGGTTCAGCTTTTCAACCTTGTTTTTTGCA
CACAGAGAAAATACCATGAGTACCTTAGGACGTGGTGTCTTGATCATATGGCTATTTGTT
GTTTTAATCATTCAATCCAGCTATACTGCAAGTCTTACTTCCATCCTGACTGTTCAACAA
CTCGATACTTCTATAAGAGGAATTGATGACCTGAAAAATAGTGATGGTCCTATTGGTTTC
CAAGTTGGTTCTTTTGCAGAAGAATACATGGTCAGGGAGCTGAACATCTCACGGTCGAGG
CTGAGAGCTCTTGGTTCTCCAGAAGAATACGCTGAAGCGCTTAAGCATGGCCCTAAGAGA
GGAGGTGTCATGGCCATTGTAGATGAGCGCCCCTACGTTGAACTGTTTTTGTCAACTTAT
TGCAAGATTGCAGTTGCTGGTTCGGATTTCACCAGCAGAGGATGGGGCTTTGCATTTCCA
AGAGACTCCCCTTTGCAAATTGACCTATCGACTGCGATCCTGTCACTGTCGGAGAACGGG
GAACTGCAGAGGATCCATGACAAATGGCTCAAGACTAGCGAGTGCTCAGCCGACAACACC
GAGTTTGTCGACTCGGATCAGCTCCGCCTTGAGAGCTTCTGGGGCCTGTTCCTCATTTGT
GGTATCGCATGTGTCATCGCGCTGCTCATCTACTTTTTCACCACCGTACGCAAATTCCTC
AGGCATGAACCTCCAGAAGATCCAACACCTCGTCCAGGCGGATCAACAACTCTTCCAGAC
GAACGAACACCCCCAAAGAACGGACAAGAGAAATGCAACTGCAGAAATTTCATCTCATTT
CTTGATCACAAGGAGCCACCAAAGAAGAAGCGGTCCTTGAGTTTGACGCCGACAACGCCA
TTGAGCAACTTTACTGCCCTTGAAATAGAAGGACCTGTGAGGACAGTCAGGAATGGTAGT
GTCGTTGACATATAG

Protein

945 aa

>Os02t0117500-01 Similar to Glutamate receptor 3.3 precursor (Ligand-gated ion channel 3.3).
MKIGLLMLLVLFLVMSPDGIRRSLAARPSIVNIGAILRFNSTIGGVSMIAIQAALEDINS
DSTILNGTTLKVDMRDTNCDDGFLGMVEALQFMETDVIAIIGPQCSTIAHIVSYVANELR
VPLMSFASDATLSSIQFPFFVRTAPSDLYQMDAVAAIVDYYRWKIVTAIYIDDDYGRNGI
ATLDDALTQRRCKISYKIAFPANARKSDLINLLVSVSYMESRVIILHTGAGPGLKIFSLA
NQLSMMGNGYVWIATDWLSAYLDANSSVPDETMYGMQGVLTLRPHIPESKMKSNLISKWS
RLSKKYSYSYLRTSSYAFYVYDSVWAVARALDAFFDDGGKISFSNDSRLRDETGGTLHLE
AMSIFDMGNNLLEKIRKANFTGVSGQVQFDATGDLIHPAYDVINIIGNGMRTVGYWSNYS
SLLSTVLPEVLYSEPPNNSLANQHLYDVIWPGQTAQTPRGWVFPSNAKELKIGVPNRFSF
REFVTKDNVTGSMKGYCIDVFTQALALLPYPVTYKFIPFGGGNENPHYDKLVQMVEDNEF
DAAIGDIAITMSRTVTTDFTQPFIESGLVILAPVKKHIVNSWAFLQPFTLQMWCVTGLFF
LVVGAVVWVLEHRINDEFRGSPREQIITIFWFSFSTLFFAHRENTMSTLGRGVLIIWLFV
VLIIQSSYTASLTSILTVQQLDTSIRGIDDLKNSDGPIGFQVGSFAEEYMVRELNISRSR
LRALGSPEEYAEALKHGPKRGGVMAIVDERPYVELFLSTYCKIAVAGSDFTSRGWGFAFP
RDSPLQIDLSTAILSLSENGELQRIHDKWLKTSECSADNTEFVDSDQLRLESFWGLFLIC
GIACVIALLIYFFTTVRKFLRHEPPEDPTPRPGGSTTLPDERTPPKNGQEKCNCRNFISF
LDHKEPPKKKRSLSLTPTTPLSNFTALEIEGPVRTVRNGSVVDI*

5'UTR

chr02:918797..918954 (+ strand) : 158 bp

chr02:920055..920127 (+ strand) : 73 bp

CDS

chr02:920128..920392 (+ strand) : 265 bp

chr02:920491..921839 (+ strand) : 1349 bp

chr02:921921..922198 (+ strand) : 278 bp

chr02:922534..922565 (+ strand) : 32 bp

chr02:922654..923060 (+ strand) : 407 bp

chr02:923210..923713 (+ strand) : 504 bp

3'UTR

chr02:923714..923968 (+ strand) : 255 bp

FASTA

>Os02t0117500-01 class=Sequence position=chr02:918797..923968 (+ strand)
ACCAGAAAAT GTGCTGAAAA TGAGCTTCGC GAAAGCTCAC GCGGTCTTCT TCAGAGAGAG GGGTCCCTAC TCCGTGTCGA
GCTGAGCAGC AGCAGCAGCA GCAGCCCGCG AGCCCAAAGA TTTCCTCTTT CGTGGGGGAG ACACGCCAAA TCCAATCCGT
AAGTTGATTT TCTCTCTCTC AGATTGATGG ATGCTACCGC TTAGCAAAGA ATGTCGCATC TTTGTACCGT TTCTCGTTCT
TGGCTCCGAA TCTCATCTTT TTCCTCCTGC CAATGCGTAC GCATTCGTGT TTTTTTTCTT GGGCTAGTTC CCCTCCCCTA
CTGGTTGTTG ATTGATCCTA AGTAATAATG GTTCCTGACA TTCTTGGGGA TATGTCCATG CGTTGAGTTC TTGTAGGTTC
AATCCGTTCA TTTTTCAGTG GTAGATAACA AGCACAAAAC ACATGAAAGG TTGAGTTTTT TTTTTCCTGT TTAGGTCGTT
TGGTTACTTG CCATTCCAGA CTTCCACTCA CTGTTTCCTG CAGGTCTAAA AGTCTCAGGG GAGCATTGTG CAGTAGTATG
TTTTTTTTTA AGGAAATGCA GTAGTATGTT TGTTTTGTTT GTTTATTGAT GTCTGATTGA CACAGGGGAT AGAATAAATA
CTTCCATGGG TTCTTATGCC TAGTGCAATG GAAGGATTAG CACTGCAACT TTCGTTCTTT TCACAGACAA AGTGTATGGA
ATATGTGGAG TCCACAACTC CACATTGCTT CTTGGTTTGT TGTGCAGAGT CCGTATGAAC AAAGCTGGCA CCGAATCACG
CTTGCCCAAT GAAACTCGGA TGTGCCTTAC CTTTCTTTTA GCCTGATGCT CATCACTGTT GTGATTTGTT CTGGGATCGC
CCTTCTGTGA AGAAATCGGA TAGCTTGCAT CAGTCATTAC ATTGTGTAAG CAATAGCATA CCAGAAATGA GTGTTTCCAT
AATTCGATTC GTCATGTATC GAGTTTAATC ATCTGCATTT GTTATGTCAC GTTGTTTTTC TTGCAATATA TGGGATGAAT
CTGTCGATTT TGTTCTCATA ATTACTTCCT TCACATTGGC ATCTGTTTTG TCACTTTGGT GTGTTCCTTT TCTTTGTTAT
TTTTTTCCTT TCAACTTTTG TACTGAAGAT TCAAATGTTG ATAGAAATTT ACATGGGGTA TGCTAGTTTC GGAAGAAAAA
AAAATGATTT ACGCGTTGTT ATCTCAATGA CAAATACTCT CTATCTTCTT TGTGGCAGGA GTTCTCCAAC TCATCAATAA
TCTGCAAGAT GTGAATAAGT CTCAAGTAGA CTTTGCACCA TTTGAGACAC AATGAAGATA GGTCTGCTCA TGTTGCTTGT
TCTCTTCCTG GTCATGTCCC CTGATGGGAT CCGCAGGAGC TTAGCCGCGA GGCCTTCTAT TGTGAATATT GGGGCCATTC
TTCGATTTAA CTCCACCATT GGAGGTGTTT CGATGATTGC TATCCAGGCA GCCTTGGAGG ATATTAATTC TGATTCAACA
ATTCTAAATG GAACAACTTT AAAAGTTGAC ATGAGGGATA CAAATTGTGA TGATGGTTTC CTTGGGATGG TTGAAGGTAG
GCTAGCTGTT ACACTCCTTT CATTTTGTTT GCATTGTTAA ATAGAATGTG CTTTGTGTTG TGGAGTTCTG ATGATACTAC
ATTCTTTGTA TCAGCTTTGC AGTTCATGGA GACTGATGTG ATTGCAATTA TTGGCCCACA GTGCTCAACA ATTGCACATA
TCGTTTCATA TGTAGCAAAT GAGCTCCGAG TCCCTCTTAT GTCCTTTGCA TCTGATGCAA CTTTGTCATC AATTCAGTTC
CCATTCTTTG TTCGAACTGC TCCCAGTGAT CTCTATCAAA TGGATGCTGT AGCTGCAATA GTTGACTACT ACCGTTGGAA
GATAGTGACT GCTATATATA TTGATGATGA TTATGGCCGA AATGGAATAG CCACATTGGA TGATGCACTT ACTCAAAGGC
GCTGCAAAAT CTCCTACAAG ATTGCATTTC CTGCAAATGC TAGAAAGAGC GACCTCATAA ATTTATTGGT CAGCGTTAGT
TATATGGAGT CTCGTGTTAT CATCCTCCAT ACTGGTGCTG GACCTGGACT CAAGATTTTC TCTCTGGCGA ACCAACTAAG
CATGATGGGC AATGGCTATG TATGGATTGC AACTGATTGG CTTTCTGCTT ATCTCGATGC TAATTCATCG GTTCCTGATG
AGACTATGTA TGGCATGCAA GGAGTTCTCA CTTTACGCCC ACACATTCCT GAATCAAAGA TGAAGAGTAA TTTGATCTCC
AAGTGGAGCA GGTTAAGCAA GAAGTACAGT TATAGTTATC TCCGCACAAG TTCATATGCT TTTTATGTTT ATGATAGTGT
ATGGGCAGTA GCTCGGGCTT TGGATGCTTT CTTTGATGAT GGTGGGAAGA TTTCCTTTTC AAATGATTCA AGGCTGCGTG
ATGAAACTGG AGGTACTCTT CACCTTGAAG CAATGAGTAT TTTTGATATG GGAAATAACT TGTTGGAGAA GATTAGAAAG
GCAAACTTCA CTGGGGTGTC TGGGCAAGTG CAATTTGATG CTACTGGTGA CCTCATTCAT CCTGCTTATG ATGTCATAAA
TATAATTGGA AATGGCATGC GGACAGTTGG CTATTGGTCA AATTATTCTA GCTTGCTGTC GACTGTCCTT CCGGAGGTTC
TCTATTCAGA GCCTCCTAAC AATTCTCTAG CTAATCAACA TCTATATGAT GTTATTTGGC CTGGGCAGAC TGCACAAACG
CCTCGAGGCT GGGTTTTTCC TTCTAATGCT AAGGAGTTGA AAATTGGTGT CCCCAACAGA TTTAGCTTCA GAGAATTTGT
CACAAAAGAT AATGTTACTG GATCAATGAA GGGCTATTGC ATTGATGTCT TTACTCAGGC ATTGGCTTTG CTTCCTTATC
CTGTTACATA CAAGTTTATA CCATTTGGGG GTGGTAATGA AAATCCACAT TATGACAAAC TCGTACAAAT GGTTGAGGAT
AACGTAAGTA TGGACAAGTG ATGCTTTTCT TCTTCTGCAC TTTCTATCAC AGGTGATATT GATCAGAATT TTCCTATCCT
GCAGGAGTTT GACGCAGCAA TAGGGGATAT TGCAATTACA ATGAGCAGGA CTGTAACTAC TGATTTCACC CAGCCCTTCA
TTGAATCTGG CTTGGTTATC TTGGCTCCAG TTAAAAAACA TATTGTTAAT TCCTGGGCAT TCTTGCAGCC ATTCACTCTT
CAGATGTGGT GTGTTACTGG ATTATTCTTT CTTGTTGTGG GTGCAGTTGT TTGGGTTCTT GAACATCGAA TAAATGACGA
ATTCCGTGGC TCACCGCGAG AACAAATAAT TACTATTTTC TGGTATGGAG CTGATTTGAA CATTTTGTAT CATCTGCCCA
CTTGTCAATC AATCTACAGA TATTAAGATA CAAAAAAACC TTTTTTGCAA TACATTGCAC ATAGCTAGCA CCTTAAAAAT
CCTGTTTCTA TATTTCTACA CAGCCAAGTC CTCCAATTTG CATGTGTAAA TGAGGTATTG ATGAGCAATG CACCTAAACC
TTGTTTTACG TATTCTCTGC ATATGCAGAA TCTATTGCAT ATGATAGTAT GATGCATTAC TTGCACATTG CTTGCTTGAT
GGTGTGCATC TTTGCTACCA AATTTGTGAC CTTAATCTCA ATTTTTATAT TCTACAGGTT CAGCTTTTCA ACCTTGTTTT
TTGCACACAG TGAGTAAACC AACCTTCTAT TATATGTTTT TTGGGGCAAA AGTAATATTT CAGTCTGACA CATTGCTTTC
ATCTCTATCT GCTCCAGGAG AAAATACCAT GAGTACCTTA GGACGTGGTG TCTTGATCAT ATGGCTATTT GTTGTTTTAA
TCATTCAATC CAGCTATACT GCAAGTCTTA CTTCCATCCT GACTGTTCAA CAACTCGATA CTTCTATAAG AGGAATTGAT
GACCTGAAAA ATAGTGATGG TCCTATTGGT TTCCAAGTTG GTTCTTTTGC AGAAGAATAC ATGGTCAGGG AGCTGAACAT
CTCACGGTCG AGGCTGAGAG CTCTTGGTTC TCCAGAAGAA TACGCTGAAG CGCTTAAGCA TGGCCCTAAG AGAGGAGGTG
TCATGGCCAT TGTAGATGAG CGCCCCTACG TTGAACTGTT TTTGTCAACT TATTGCAAGA TTGCAGTTGC TGGTTCGGAT
TTCACCAGCA GAGGATGGGG CTTTGTAAGT ACATTTAAAC TTGATTTTCT TTAACATGGA TTAGAAAAAC AAAGAGAAAA
CAACTAGACA CAAAATATAA CAACTTAGCT TATGAAGTAC TACTTGTTTC TCATCATTAA AACATAGTGC TTAATAAAGT
TCACTCTTAT CAGGCATTTC CAAGAGACTC CCCTTTGCAA ATTGACCTAT CGACTGCGAT CCTGTCACTG TCGGAGAACG
GGGAACTGCA GAGGATCCAT GACAAATGGC TCAAGACTAG CGAGTGCTCA GCCGACAACA CCGAGTTTGT CGACTCGGAT
CAGCTCCGCC TTGAGAGCTT CTGGGGCCTG TTCCTCATTT GTGGTATCGC ATGTGTCATC GCGCTGCTCA TCTACTTTTT
CACCACCGTA CGCAAATTCC TCAGGCATGA ACCTCCAGAA GATCCAACAC CTCGTCCAGG CGGATCAACA ACTCTTCCAG
ACGAACGAAC ACCCCCAAAG AACGGACAAG AGAAATGCAA CTGCAGAAAT TTCATCTCAT TTCTTGATCA CAAGGAGCCA
CCAAAGAAGA AGCGGTCCTT GAGTTTGACG CCGACAACGC CATTGAGCAA CTTTACTGCC CTTGAAATAG AAGGACCTGT
GAGGACAGTC AGGAATGGTA GTGTCGTTGA CATATAGAAC TAGTGTGTGT AAAAAGCTGA GATGTTATAT ATTTTGGATC
TGAGATATGC CATCTTTCGG TCAATCTCCT CAATTTTAGT TGAGAGAAAA TATAATCAGA GGCTGCATAA GATGCTATCT
GTAGATTTCA AGCAAATCCG GTGATGGGAA AAATTCATTT GAGGCCAGTT TGGCAACTGA AAAACTGTAT AGAAAGTTAT
TCTTGTCCTT GATGGTATTT TGAATGGAGG AAATATATAC GTCTGTTTGA TT