Os02t0120100-01

Locus

Os02g0120100

Description

Serine/threonine/tyrosine protein kinase, STY kinase, Regulation of ammonium uptake

RAP-DB Gene Symbol Synonym(s)

OsACTPK1

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ACTPK1

CGSNL Gene Name

ACT DOMAIN CONTAINING PROTEIN KINASE 1

Oryzabase Gene Symbol Synonym(s)

OsACTPK1, ACTPK1-1, ACTPK1-2

Oryzabase Gene Name Synonym(s)

ACT domain containing protein kinase 1

Transcript Evidence

AK103704

Protein Evidence

Q6YUS6

Literature

PMID: 29356222

Note

Manual Curation

March 9, 2018

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: ATP binding (GO:0005524)

Functional domain (InterPro)

Protein kinase-like domain superfamily (IPR011009)

ACT domain (IPR002912)

Protein kinase domain (IPR000719)

Serine-threonine/tyrosine-protein kinase, catalytic domain (IPR001245)

Serine/threonine-protein kinase, active site (IPR008271)

Experimentally confirmed subcellular location

plasma membrane

Full-length cDNA

J033136N12 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0120100-01)

RiceXPro (AK103704)

Others

Oryzabase (22315)

KEGG (Os02t0120100-01)

Transcript

2250 bp

>Os02t0120100-01 Serine/threonine/tyrosine protein kinase, STY kinase, Regulation of ammonium uptake
GTTTGTGTCTATAAAGTTGTGGACTTTCTCGCCGCCATTGTCACGTCTCACGTGCGCGCC
ACCACCACCCCATGCAGACCCAGCAGCAGTAGCGGCACGGCTCTCCTCTCTCGTCTCGTG
CACCACGCCGCCGCGCGCGCTCGCTTTGCTTCGAGAGTAATCGATGGCCGTGGAGGAGTC
GCCGCCGCCGCCGCCGTCGTCCCCGCCGCCGCCGCCGTCGTCCCCGCAGCCAGCGGCGGA
GGTCGGCGCGGGGGGACGGCGCGCGGACAAGAGCGGGCGCCGCCTCGAGGTGTACAGCGA
GGTACTCGCCCGCCTCCGGGGCCTCGGCGCCGCCGCCCCCGTCGAGATCTCGCCGGCCTA
CGAGGACGCGCTCTGGGCCCACTTCCACCGCCTCCCCGCCCGGTACGCGCTGGATGTGCA
CGCGGATAGGGCGGAGGACGTGGTGACGCACCACCGGTTGCTGGAGGAGGCGCGCGATCC
GGACCGGCGGCCCGCCTTGTCGGTGCGCGTCGTCCAGGTTTCTAGGATTCTTGATGGTGA
TATGGATGATTGTTCTGAGCTTGGGATGGAGCCGGTTCATACCAACCACTTGGCAAGACA
AATGGTTCATCCCCCTCCTGCCTTTGGTTCTTGCTCCAACTTAGAGGCACTTGCGCTCGA
GGCGAGTGAGGCTAATCTAAGGAGCAGTAACAATGATGAAGATAGCAGTGTTCATCTCAT
TTCCAGGCCAATGCATGAGATAACTTTTGCAACAACTGATAAGCCAAAGGTCCTTAGTCA
GCTGACTTGCTTGCTTAGTGAGCTTGGTCTTGACATCCAAGAAGCGCATGCATTTTCAAC
AAGTGATGGTTACTCATTGGATGTATTTGTTGTCACTGGTTGGCACCTTGGGGGTACTGA
GCAGCTAAAAGAAAAGTTGCTGGAGAAGTTTCATGACATTGAGACACAAGCTTGGCCAAC
ATCAAACTCATCGTCACAATCATTGGAAGGTCCGTCAGGTGGAGAGAGTATGCCATCTAC
CAGTGTGGAAATACCAACAGATGGGACGGATGTTTGGGAGATAGATCTCAAGCTTCTCAA
GTTTGGAACCAAGGTTGCTTCTGGATCAAATGGCGATCTGTTCCGTGGATCATACTGCAG
TCAGGATGTAGCTATTAAAGTAGTGAGACCTGAACGCATTAGTGCAGATATGTACCGTGA
TTTTGCACAGGAAGTCTACATTATGAGAAAGGTCCGCCATAGAAATGTTGTACAGTTTAT
CGGTGCCTGTACAAGACAGCCCAACTTATATATTGTAACAGATTTCATGTCAGGAGGTAG
TCTGCATGATTACCTTCATAAAAAGAACAATTCTTTCAAGCTATCCGAAATACTGAGAGT
GGCGACAGATATCTCTAAAGGAATGAACTATCTGCATCAGAACAACATAATTCACCGTGA
TCTCAAGACAGCGAATCTTCTTATGGATGAAAACAAGGTCGTAAAGGTTGCAGATTTTGG
TGTTGCACGTGTCAAAGATCAATCCGGAGTGATGACTGCAGAGACTGGAACTTATCGTTG
GATGGCACCTGAGGTCATTGAACATAAGCCCTATGATCATAAAGCAGATGTTTTTAGCTT
TGGTATTGTTCTATGGGAGCTGCTAACTGGCAAGATACCCTATGAGTACCTAACACCACT
ACAAGCAGCCATAGGTGTTGTTCAGAAGGGCCTTAGACCAACAATTCCGAAAGATACGCA
CCCCAAGCTGTCTGAGCTGCTTCAGAAATGCTGGCATAGAGATCCTGCTGAAAGGCCTGA
CTTCTCCCAGATACTGGAGATTCTTCAGAGACTCCCCAAAGAGGTGAGAGCTGATACCGA
GGGTCGCCAGAAATCAAAGGCAGGATTTCTTTCAGCATTGAAGAGAAACCACTGAAAGTA
GCTTATACAATGTTGGTGCATCATTCAATTGTAGCATCCCACAACAAGAGGGAAGCGCAT
TGTGGTGTACAGTGATTAAAAAAAAAGTATTTCTTACGTTGTTGCAGCTTTGTTTTTTTT
GCTTATTTAGTTTTTTTTTCAGCTTTTTGGTTTCTTTTGCTGTTGTTTTTCTTGTTCTAG
TTTTGTTGCATTAATGAGAACAAGTATAGAAAAAGGAATGTGCTGAAAAGAGTTGTACAA
ATTGATCCTGTTTTCTTGTTCATGTCTGAATTCCGATTTTCTCCTCCTATGTTGTAGATG
AAAATCTTGTAGTGTATGCCTATATTTTCC

CDS

1752 bp

>Os02t0120100-01 Serine/threonine/tyrosine protein kinase, STY kinase, Regulation of ammonium uptake
ATGGCCGTGGAGGAGTCGCCGCCGCCGCCGCCGTCGTCCCCGCCGCCGCCGCCGTCGTCC
CCGCAGCCAGCGGCGGAGGTCGGCGCGGGGGGACGGCGCGCGGACAAGAGCGGGCGCCGC
CTCGAGGTGTACAGCGAGGTACTCGCCCGCCTCCGGGGCCTCGGCGCCGCCGCCCCCGTC
GAGATCTCGCCGGCCTACGAGGACGCGCTCTGGGCCCACTTCCACCGCCTCCCCGCCCGG
TACGCGCTGGATGTGCACGCGGATAGGGCGGAGGACGTGGTGACGCACCACCGGTTGCTG
GAGGAGGCGCGCGATCCGGACCGGCGGCCCGCCTTGTCGGTGCGCGTCGTCCAGGTTTCT
AGGATTCTTGATGGTGATATGGATGATTGTTCTGAGCTTGGGATGGAGCCGGTTCATACC
AACCACTTGGCAAGACAAATGGTTCATCCCCCTCCTGCCTTTGGTTCTTGCTCCAACTTA
GAGGCACTTGCGCTCGAGGCGAGTGAGGCTAATCTAAGGAGCAGTAACAATGATGAAGAT
AGCAGTGTTCATCTCATTTCCAGGCCAATGCATGAGATAACTTTTGCAACAACTGATAAG
CCAAAGGTCCTTAGTCAGCTGACTTGCTTGCTTAGTGAGCTTGGTCTTGACATCCAAGAA
GCGCATGCATTTTCAACAAGTGATGGTTACTCATTGGATGTATTTGTTGTCACTGGTTGG
CACCTTGGGGGTACTGAGCAGCTAAAAGAAAAGTTGCTGGAGAAGTTTCATGACATTGAG
ACACAAGCTTGGCCAACATCAAACTCATCGTCACAATCATTGGAAGGTCCGTCAGGTGGA
GAGAGTATGCCATCTACCAGTGTGGAAATACCAACAGATGGGACGGATGTTTGGGAGATA
GATCTCAAGCTTCTCAAGTTTGGAACCAAGGTTGCTTCTGGATCAAATGGCGATCTGTTC
CGTGGATCATACTGCAGTCAGGATGTAGCTATTAAAGTAGTGAGACCTGAACGCATTAGT
GCAGATATGTACCGTGATTTTGCACAGGAAGTCTACATTATGAGAAAGGTCCGCCATAGA
AATGTTGTACAGTTTATCGGTGCCTGTACAAGACAGCCCAACTTATATATTGTAACAGAT
TTCATGTCAGGAGGTAGTCTGCATGATTACCTTCATAAAAAGAACAATTCTTTCAAGCTA
TCCGAAATACTGAGAGTGGCGACAGATATCTCTAAAGGAATGAACTATCTGCATCAGAAC
AACATAATTCACCGTGATCTCAAGACAGCGAATCTTCTTATGGATGAAAACAAGGTCGTA
AAGGTTGCAGATTTTGGTGTTGCACGTGTCAAAGATCAATCCGGAGTGATGACTGCAGAG
ACTGGAACTTATCGTTGGATGGCACCTGAGGTCATTGAACATAAGCCCTATGATCATAAA
GCAGATGTTTTTAGCTTTGGTATTGTTCTATGGGAGCTGCTAACTGGCAAGATACCCTAT
GAGTACCTAACACCACTACAAGCAGCCATAGGTGTTGTTCAGAAGGGCCTTAGACCAACA
ATTCCGAAAGATACGCACCCCAAGCTGTCTGAGCTGCTTCAGAAATGCTGGCATAGAGAT
CCTGCTGAAAGGCCTGACTTCTCCCAGATACTGGAGATTCTTCAGAGACTCCCCAAAGAG
GTGAGAGCTGATACCGAGGGTCGCCAGAAATCAAAGGCAGGATTTCTTTCAGCATTGAAG
AGAAACCACTGA

Protein

584 aa

>Os02t0120100-01 Serine/threonine/tyrosine protein kinase, STY kinase, Regulation of ammonium uptake
MAVEESPPPPPSSPPPPPSSPQPAAEVGAGGRRADKSGRRLEVYSEVLARLRGLGAAAPV
EISPAYEDALWAHFHRLPARYALDVHADRAEDVVTHHRLLEEARDPDRRPALSVRVVQVS
RILDGDMDDCSELGMEPVHTNHLARQMVHPPPAFGSCSNLEALALEASEANLRSSNNDED
SSVHLISRPMHEITFATTDKPKVLSQLTCLLSELGLDIQEAHAFSTSDGYSLDVFVVTGW
HLGGTEQLKEKLLEKFHDIETQAWPTSNSSSQSLEGPSGGESMPSTSVEIPTDGTDVWEI
DLKLLKFGTKVASGSNGDLFRGSYCSQDVAIKVVRPERISADMYRDFAQEVYIMRKVRHR
NVVQFIGACTRQPNLYIVTDFMSGGSLHDYLHKKNNSFKLSEILRVATDISKGMNYLHQN
NIIHRDLKTANLLMDENKVVKVADFGVARVKDQSGVMTAETGTYRWMAPEVIEHKPYDHK
ADVFSFGIVLWELLTGKIPYEYLTPLQAAIGVVQKGLRPTIPKDTHPKLSELLQKCWHRD
PAERPDFSQILEILQRLPKEVRADTEGRQKSKAGFLSALKRNH*

5'UTR

chr02:1056668..1056830 (- strand) : 163 bp

CDS

chr02:1056429..1056667 (- strand) : 239 bp

chr02:1056235..1056349 (- strand) : 115 bp

chr02:1055922..1056007 (- strand) : 86 bp

chr02:1055667..1055789 (- strand) : 123 bp

chr02:1054493..1054547 (- strand) : 55 bp

chr02:1054154..1054264 (- strand) : 111 bp

chr02:1053952..1054002 (- strand) : 51 bp

chr02:1053543..1053718 (- strand) : 176 bp

chr02:1053346..1053453 (- strand) : 108 bp

chr02:1053139..1053212 (- strand) : 74 bp

chr02:1052877..1053053 (- strand) : 177 bp

chr02:1052667..1052761 (- strand) : 95 bp

chr02:1052501..1052581 (- strand) : 81 bp

chr02:1052343..1052396 (- strand) : 54 bp

chr02:1051378..1051512 (- strand) : 135 bp

chr02:1051121..1051192 (- strand) : 72 bp

3'UTR

chr02:1050786..1051120 (- strand) : 335 bp

FASTA

>Os02t0120100-01 class=Sequence position=chr02:1050786..1056830 (- strand)
GTTTGTGTCT ATAAAGTTGT GGACTTTCTC GCCGCCATTG TCACGTCTCA CGTGCGCGCC ACCACCACCC CATGCAGACC
CAGCAGCAGT AGCGGCACGG CTCTCCTCTC TCGTCTCGTG CACCACGCCG CCGCGCGCGC TCGCTTTGCT TCGAGAGTAA
TCGATGGCCG TGGAGGAGTC GCCGCCGCCG CCGCCGTCGT CCCCGCCGCC GCCGCCGTCG TCCCCGCAGC CAGCGGCGGA
GGTCGGCGCG GGGGGACGGC GCGCGGACAA GAGCGGGCGC CGCCTCGAGG TGTACAGCGA GGTACTCGCC CGCCTCCGGG
GCCTCGGCGC CGCCGCCCCC GTCGAGATCT CGCCGGCCTA CGAGGACGCG CTCTGGGCCC ACTTCCACCG CCTCCCCGCC
CGGTGAGATC TCTTCTCCTG CCCTCTCTCT CCCCCTCCCT CCCCCTCCCC GACTTCCCTC ATGGCCATGG CGGGCGTGCA
GGTACGCGCT GGATGTGCAC GCGGATAGGG CGGAGGACGT GGTGACGCAC CACCGGTTGC TGGAGGAGGC GCGCGATCCG
GACCGGCGGC CCGCCTTGTC GGTGCGCGTC GTCCAGGTGA GAGAGATCCA TCCATGGCTG CCTGCATGTC GGTCGATTTC
GCGTACTGCT TAATTTCCAT TAGATTTTTA TTTCTCTCCT GTGGTGTTGC TCGGGGAATT TGATTTGTGC TGTCTCATGT
TGTTCATTAG ATCAAACTGA AGAGTAGAGC TTAGATGTTG CATCAAACTG AAGAGACATT TTAATTCCTT GGCTTACCAA
ACTTTGTTTT CTGCTTGATC TAGGTTTCTA GGATTCTTGA TGGTGATATG GATGATTGTT CTGAGCTTGG GATGGAGCCG
GTTCATACCA ACCACTTGGC AAGACAAATG TATGCATGAT CTATCTATCT ATCTATCTAT ATGCACATGA AGTTCGTTTA
CTTTCATGCA TGTGTCTCCT TGGCTGTTCT TGTCTTTTAT GCACGCTAAT GGAGTAATGG TGACTACACA AATCGTTTCA
GGGTTCATCC CCCTCCTGCC TTTGGTTCTT GCTCCAACTT AGAGGCACTT GCGCTCGAGG CGAGTGAGGC TAATCTAAGG
AGCAGTAACA ATGATGAAGA TAGCAGTGTT CATCTCATTT CCAGGTAGAT AATTCCCCTT TTCAGTTCAC GTGTACCTCG
CTTTATTTTG AGTTTAgggc ccctttgatt tgaatgaaaa acataggatt tttgtaagat tcaaatccta taggtttttt
ttcctatctg gccctttgaa acaaatgatt gaaaactgtt gaatcctatg aaattcttaa ggaatgctct attccataca
agttttggag gatttttaac atgaggtcca acctcatgga aagttttcta tgagtctatc tctctcattc aatttttgaa
tttttcctgt gttttacaat cctctatttt gcgtttgaat tcctatcgaa attctgtgtt tttcctattc ctttgttttc
tcaatcccgt gtttcaGAGG AGCCCACTGT ATTTGTCTTT GGTTCTTTTG GTTCATGTGC CATTCTGTAC AATCATAGCG
TGCTTAGCAC TAGCTTGTAG TCTTGTACTA CTACCTTACA AGGTTGGCAT GTCGGCATGT TGCGATTCCC TTTTAAAAAC
TGTTTTTGAT ACTTCTCTAT ATCAATTAAT TAACATGGTA TATTGTGTTA CAACCAGAAA ATCGCATATT TTACCTTGTG
AAGAATGCAT GCCTCTGTGG CCTATTTTTT AACAAATGAT AGCATCAGTG GATTAGTTGT TACTAACAGT TAGCTGCAAA
ACCATGATAT GCAGAATTTC CTTTCCGAAT ATGGTACTTT CTCTGGCAAT ATTGCATTTG CATACTTGTT TAGATGTACA
AGACATTTCA CAAAAAGCCG ATGCCACGCA TGAGCTTCTT TGTTATGCGC TGGTTTGATC ATGTAGTGAG TGGATTATGA
AATTGTCAAA AGTACTCATA ATTGGTGGGA GTAGTTCATT TTTCCAACTT AAGCCTTtat tccctccgtt tcacaatgta
agtcattcta gtatttccca cattcatatt gatgttaatg aatctagaca tgatgtggga aatgctagaa tgacttacat
tgtgaaacgg aggaagtaTT TATGGGCATT TTCATTAGGA TTATGCAAAT AGTTGATTAA TACTTGGATT CTATATATTC
TCATTCTAGT TGATTAATTC TCGCTATATT CTGAATCTTG CAGGCCAATG CATGAGATAA CTTTTGCAAC AACTGATAAG
CCAAAGGTCC TTAGTCAGGT AGGCATACTT CTTTCAATAC AATCTTAACA AAGCGAAGGA AATTCAAAAG CTGACAAGTA
GCTAGTTAGG AAAATCATTA GTAAAAATAA ATGGACATAT TTATTTAGAA AAAAAGATTA AAAAAACATT ACAAATCTGT
TTAATGTGAA CTTCAAGGCA ATTTTATACA GGACTTATGT CAGCAATTGT TTTGATTCTT ACACTTTGCC TTTCATACAC
TTGCAGCTGA CTTGCTTGCT TAGTGAGCTT GGTCTTGACA TCCAAGAAGC GCATGCATTT TCAACAAGTG ATGGTTACTC
ATTGGATGTA TTTGTTGTCA CTGGTTGGCA CCTTGGGGTA CGCACCCAGC ATAATAGTGT TACTGTGTTA GTTTGTCTTG
TCCTTATTGC AATTGGTCTT TAGAGCTAAA CGCTTCAGTA GTTCAGTTAG TTCAGTAACA TACTTCACTT TTCGTGTTGA
TAATTTGCTC TTTTGATGCA CACTGCAGGG TACTGAGCAG CTAAAAGAAA AGTTGCTGGA GAAGTTTCAT GACATTGAGG
TATAAGCTTC CCCTCACTTT CTTCTATGAA GTTCAACGAA AAAAAAAACT CATTCTCGTG GTATTAATTG TTGCCTGAAA
ATATGGTACC TGGACCTGAA AAAGGAATGC AGAACATTAT TTTCCTAACC AGTACTTGCC TTGTTCATTG CACTCATAAA
AATCTTGTAA GGTCTATTGA ATTCCTCAGA TAAAAAACAT TTGTTTTAGT TTTATTTTGG TTTCGTGTAC AGACACAAGC
TTGGCCAACA TCAAACTCAT CGTCACAATC ATTGGAAGGT CCGTCAGGTG GAGAGAGTAT GCCATCTACC AGTGTGGAAA
TACCAACAGA TGGGACGGAT GTTTGGGAGA TAGATCTCAA GCTTCTCAAG TTTGGAACCA AGGTTGCTTC TGGATCAAAT
GGCGATCTGT AAGTTCCATT ATCTTTGTCG GGAAGTGAAA ACAATATAAT TTTACACAAC TGGGGATTGA GTGCCATTTG
ATGCTTTGCT TTCTCAGGTT CCGTGGATCA TACTGCAGTC AGGATGTAGC TATTAAAGTA GTGAGACCTG AACGCATTAG
TGCAGATATG TACCGTGATT TTGCACAGGA AGTCTACATT ATGAGGTTAA CTTAATATTT TTTTATTGCT TCTCCCATTT
ATCGAGCATT TTCTGGTGTT TAGCATTTGG CAAATCATAT GCATATTGAC TTTATTGACT GTACCAAATT GTTTCTTACA
AAATCTACAT GCTTGCAGAA AGGTCCGCCA TAGAAATGTT GTACAGTTTA TCGGTGCCTG TACAAGACAG CCCAACTTAT
ATATTGTAAC AGGTATATTA CAACGGTTTA ACTTATAATC TTTGTAGACA AACTTCTGTA GTGTTTGACA CACTCTAATT
TGCATTCATT TTCTTAGATT TCATGTCAGG AGGTAGTCTG CATGATTACC TTCATAAAAA GAACAATTCT TTCAAGCTAT
CCGAAATACT GAGAGTGGCG ACAGATATCT CTAAAGGAAT GAACTATCTG CATCAGAACA ACATAATTCA CCGTGATCTC
AAGACAGCGA ATCTTCTTAT GGATGAAAAC AAGGCTAGTT TTTTCTCATC CATAATCTCA TCCATAATGC TATATGATTT
ACAGAGTGTG CAGAGTGATA TTTGCTCCTG TCATTGAACT TCTAAATGAG AGCGATCATA TTTTTCAGGT CGTAAAGGTT
GCAGATTTTG GTGTTGCACG TGTCAAAGAT CAATCCGGAG TGATGACTGC AGAGACTGGA ACTTATCGTT GGATGGCACC
TGAGGTGCCT GTTATACATA CGCTCATTCC ATAAGAATAA CAACAGCATT TTTGTTTATT CTAACATTTG TATTCTATTG
TAACTACAGG TCATTGAACA TAAGCCCTAT GATCATAAAG CAGATGTTTT TAGCTTTGGT ATTGTTCTAT GGGAGCTGCT
AACTGGCAAG GTAACTACAA ATTGCTCCAG GAAAAAGTCA ATTTCTTTCT TTCTTTTTCC AACTTATATT AATTACATAT
AAAACTAAAC TCACCTAACT ATTCAATTTC TCAGATACCC TATGAGTACC TAACACCACT ACAAGCAGCC ATAGGTGTTG
TTCAGAAGGT AAGCAAGCAT CCCTGCTTAA ATTCTGTAGT TACATGCGTG GTATCCGTAG TATTTAGCTC AAAAATTTAA
AATGTTGATG AAACCCATTG TATAGCTATG TCCTGTGGGT GCTGGATTTC TTTAGTTCAA GTGGGGGACA TGTGTGATGC
TCTAAGGATA CAGTAGTTTC GAGAAGCAGT CTTTAAAAAA TGATGGCATC CTTGTTCTTT CAAGAAACCA TTCTTTTAAT
ATGCGATTGC CTCCCTTTGT GTCCATCCTA CTAATCACTC ACCTGATTAG AGGTGCAAGT TAGGTTTTCA GGTTACCATG
CTCATGGGAA TGAGATGAAG TAGAACAAAC TTCCGTCAAG TCACGTCATT GTAGCTCCCT CAATTGTAGG GTCACATATA
ATATCTGCTT AACATCATAG ATTCTTACCA TTAGCAGAAA GTGCTATGAA TTGCATATGA AAATGATTAT GAACCTTGAT
TGTAAATGAA ATAGTTGCCG TGATTGCCAA GTAGGAGTAG TTTGAAAAGA CAAGTATTTT CAAGAGAATA TAGGTCCTTT
AGAGACACTG TACATACCTA GAAATTTCAT GGAAATTTAT TGGCATATTT ATCTATATCC TCATATACAT GCATATATAC
GGTATACCTG CTTGATTTCA TAAAGTATGG CCTTTTTTTT GGATAAAAGG CCTAAGATAG GAGATTGCCT TTGGTATCTA
AAAGAGTTGC AAGACAGCAT TTTAACTTGT ACATATGTAG CAGAGAGCTG CTAGTTATTT ACAACAATTC TACACAAAAT
TAAGGTTCAC TCATGTGTAT TTTGATCATT TTCTGCAGGG CCTTAGACCA ACAATTCCGA AAGATACGCA CCCCAAGCTG
TCTGAGCTGC TTCAGAAATG CTGGCATAGA GATCCTGCTG AAAGGCCTGA CTTCTCCCAG ATACTGGAGA TTCTTCAGAG
ACTCCCCAAA GAGGTCAGTT CTAATGCACC TCGACTCATC AATTTATCAT GCATTTCTTA AAAATTCTCA AGATTTTGTT
CTTTTACAAA AACAGAAACT ATTTGCTCAA TGAAATTTTA GTTTGTTTCA TGTTCAATAT CATGCTCCAG AAAAATATAT
ATTAAATTTT GTTTTAATAT CCTGATTTAA AAAAACAGGT GAGAGCTGAT ACCGAGGGTC GCCAGAAATC AAAGGCAGGA
TTTCTTTCAG CATTGAAGAG AAACCACTGA AAGTAGCTTA TACAATGTTG GTGCATCATT CAATTGTAGC ATCCCACAAC
AAGAGGGAAG CGCATTGTGG TGTACAGTGA TTAAAAAAAA AGTATTTCTT ACGTTGTTGC AGCTTTGTTT TTTTTGCTTA
TTTAGTTTTT TTTTCAGCTT TTTGGTTTCT TTTGCTGTTG TTTTTCTTGT TCTAGTTTTG TTGCATTAAT GAGAACAAGT
ATAGAAAAAG GAATGTGCTG AAAAGAGTTG TACAAATTGA TCCTGTTTTC TTGTTCATGT CTGAATTCCG ATTTTCTCCT
CCTATGTTGT AGATGAAAAT CTTGTAGTGT ATGCCTATAT TTTCC