Os02t0120100-02

Locus

Os02g0120100

Description

Similar to ATP binding protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ACTPK1

CGSNL Gene Name

ACT DOMAIN CONTAINING PROTEIN KINASE 1

Oryzabase Gene Symbol Synonym(s)

OsACTPK1, ACTPK1-1, ACTPK1-2

Oryzabase Gene Name Synonym(s)

ACT domain containing protein kinase 1

Transcript Evidence

AK060220 (DDBJ, Best hit)

Protein Evidence

NP_001151481.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: protein tyrosine kinase activity (GO:0004713)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

Serine-threonine/tyrosine-protein kinase (IPR001245)

Serine/threonine-protein kinase, catalytic domain (IPR002290)

Serine/threonine-protein kinase, active site (IPR008271)

Protein kinase-like domain (IPR011009)

Tyrosine-protein kinase, catalytic domain (IPR020635)

Full-length cDNA

001-002-F01 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0120100-02)

RiceXPro (AK060220)

Others

Oryzabase (22315)

KEGG (Os02t0120100-02)

Transcript

1008 bp

>Os02t0120100-02 Similar to ATP binding protein.
TAGTGAGACCTGAACGCATTAGTGCAGATATGTACCGTGATTTTGCACAGGAAGTCTACA
TTATGAGAAAGGTCCGCCATAGAAATGTTGTACAGTTTATCGGTGCCTGTACAAGACAGC
CCAACTTATATATTGTAACAGATTTCATGTCAGGAGGTAGTCTGCATGATTACCTTCATA
AAAAGAACAATTCTTTCAAGCTATCCGAAATACTGAGAGTGGCGACAGATATCTCTAAAG
GAATGAACTATCTGCATCAGAACAACATAATTCACCGTGATCTCAAGACAGCGAATCTTC
TTATGGATGAAAACAAGGTCGTAAAGGTTGCAGATTTTGGTGTTGCACGTGTCAAAGATC
AATCCGGAGTGATGACTGCAGAGACTGGAACTTATCGTTGGATGGCACCTGAGGTCATTG
AACATAAGCCCTATGATCATAAAGCAGATGTTTTTAGCTTTGGTATTGTTCTATGGGAGC
TGCTAACTGGCAAGATACCCTATGAGTACCTAACACCACTACAAGCAGCCATAGGTGTTG
TTCAGAAGGGCCTTAGACCAACAATTCCGAAAGATACGCACCCCAAGCTGTCTGAGCTGC
TTCAGAAATGCTGGCATAGAGATCCTGCTGAAAGGCCTGACTTCTCCCAGATACTGGAGA
TTCTTCAGAGACTCCCCAAAGAGGTGAGAGCTGATACCGAGGGTCGCCAGAAATCAAAGG
CAGGATTTCTTTCAGCATTGAAGAGAAACCACTGAAAGTAGCTTATACAATGTTGGTGCA
TCATTCAATTGTAGCATCCCACAACAAGAGGGAAGCGCATTGTGGTGTACAGTGATTAAA
AAAAAAGTATTTCTTACGTTGTTGCAGCTTTGTTTTTTTTGCTTATTTAGTTTTTTTTTC
AGCTTTTTGGTTTCTTTTGCTGTTGTTTTTCTTGTTCTAGTTTTGTTGCATTAATGAGAA
CAAGTATAGAAAAAGGAATGTGCTGAAAAGAGTTGTACAAATTGATCC

CDS

753 bp

>Os02t0120100-02 Similar to ATP binding protein.
GTGAGACCTGAACGCATTAGTGCAGATATGTACCGTGATTTTGCACAGGAAGTCTACATT
ATGAGAAAGGTCCGCCATAGAAATGTTGTACAGTTTATCGGTGCCTGTACAAGACAGCCC
AACTTATATATTGTAACAGATTTCATGTCAGGAGGTAGTCTGCATGATTACCTTCATAAA
AAGAACAATTCTTTCAAGCTATCCGAAATACTGAGAGTGGCGACAGATATCTCTAAAGGA
ATGAACTATCTGCATCAGAACAACATAATTCACCGTGATCTCAAGACAGCGAATCTTCTT
ATGGATGAAAACAAGGTCGTAAAGGTTGCAGATTTTGGTGTTGCACGTGTCAAAGATCAA
TCCGGAGTGATGACTGCAGAGACTGGAACTTATCGTTGGATGGCACCTGAGGTCATTGAA
CATAAGCCCTATGATCATAAAGCAGATGTTTTTAGCTTTGGTATTGTTCTATGGGAGCTG
CTAACTGGCAAGATACCCTATGAGTACCTAACACCACTACAAGCAGCCATAGGTGTTGTT
CAGAAGGGCCTTAGACCAACAATTCCGAAAGATACGCACCCCAAGCTGTCTGAGCTGCTT
CAGAAATGCTGGCATAGAGATCCTGCTGAAAGGCCTGACTTCTCCCAGATACTGGAGATT
CTTCAGAGACTCCCCAAAGAGGTGAGAGCTGATACCGAGGGTCGCCAGAAATCAAAGGCA
GGATTTCTTTCAGCATTGAAGAGAAACCACTGA

Protein

251 aa

>Os02t0120100-02 Similar to ATP binding protein.
VRPERISADMYRDFAQEVYIMRKVRHRNVVQFIGACTRQPNLYIVTDFMSGGSLHDYLHK
KNNSFKLSEILRVATDISKGMNYLHQNNIIHRDLKTANLLMDENKVVKVADFGVARVKDQ
SGVMTAETGTYRWMAPEVIEHKPYDHKADVFSFGIVLWELLTGKIPYEYLTPLQAAIGVV
QKGLRPTIPKDTHPKLSELLQKCWHRDPAERPDFSQILEILQRLPKEVRADTEGRQKSKA
GFLSALKRNH*

5'UTR

chr02:1053411..1053412 (- strand) : 2 bp

CDS

chr02:1053346..1053410 (- strand) : 65 bp

chr02:1053139..1053212 (- strand) : 74 bp

chr02:1052877..1053053 (- strand) : 177 bp

chr02:1052667..1052761 (- strand) : 95 bp

chr02:1052501..1052581 (- strand) : 81 bp

chr02:1052343..1052396 (- strand) : 54 bp

chr02:1051378..1051512 (- strand) : 135 bp

chr02:1051121..1051192 (- strand) : 72 bp

3'UTR

chr02:1050868..1051120 (- strand) : 253 bp

FASTA

>Os02t0120100-02 class=Sequence position=chr02:1050868..1053412 (- strand)
TAGTGAGACC TGAACGCATT AGTGCAGATA TGTACCGTGA TTTTGCACAG GAAGTCTACA TTATGAGGTT AACTTAATAT
TTTTTTATTG CTTCTCCCAT TTATCGAGCA TTTTCTGGTG TTTAGCATTT GGCAAATCAT ATGCATATTG ACTTTATTGA
CTGTACCAAA TTGTTTCTTA CAAAATCTAC ATGCTTGCAG AAAGGTCCGC CATAGAAATG TTGTACAGTT TATCGGTGCC
TGTACAAGAC AGCCCAACTT ATATATTGTA ACAGGTATAT TACAACGGTT TAACTTATAA TCTTTGTAGA CAAACTTCTG
TAGTGTTTGA CACACTCTAA TTTGCATTCA TTTTCTTAGA TTTCATGTCA GGAGGTAGTC TGCATGATTA CCTTCATAAA
AAGAACAATT CTTTCAAGCT ATCCGAAATA CTGAGAGTGG CGACAGATAT CTCTAAAGGA ATGAACTATC TGCATCAGAA
CAACATAATT CACCGTGATC TCAAGACAGC GAATCTTCTT ATGGATGAAA ACAAGGCTAG TTTTTTCTCA TCCATAATCT
CATCCATAAT GCTATATGAT TTACAGAGTG TGCAGAGTGA TATTTGCTCC TGTCATTGAA CTTCTAAATG AGAGCGATCA
TATTTTTCAG GTCGTAAAGG TTGCAGATTT TGGTGTTGCA CGTGTCAAAG ATCAATCCGG AGTGATGACT GCAGAGACTG
GAACTTATCG TTGGATGGCA CCTGAGGTGC CTGTTATACA TACGCTCATT CCATAAGAAT AACAACAGCA TTTTTGTTTA
TTCTAACATT TGTATTCTAT TGTAACTACA GGTCATTGAA CATAAGCCCT ATGATCATAA AGCAGATGTT TTTAGCTTTG
GTATTGTTCT ATGGGAGCTG CTAACTGGCA AGGTAACTAC AAATTGCTCC AGGAAAAAGT CAATTTCTTT CTTTCTTTTT
CCAACTTATA TTAATTACAT ATAAAACTAA ACTCACCTAA CTATTCAATT TCTCAGATAC CCTATGAGTA CCTAACACCA
CTACAAGCAG CCATAGGTGT TGTTCAGAAG GTAAGCAAGC ATCCCTGCTT AAATTCTGTA GTTACATGCG TGGTATCCGT
AGTATTTAGC TCAAAAATTT AAAATGTTGA TGAAACCCAT TGTATAGCTA TGTCCTGTGG GTGCTGGATT TCTTTAGTTC
AAGTGGGGGA CATGTGTGAT GCTCTAAGGA TACAGTAGTT TCGAGAAGCA GTCTTTAAAA AATGATGGCA TCCTTGTTCT
TTCAAGAAAC CATTCTTTTA ATATGCGATT GCCTCCCTTT GTGTCCATCC TACTAATCAC TCACCTGATT AGAGGTGCAA
GTTAGGTTTT CAGGTTACCA TGCTCATGGG AATGAGATGA AGTAGAACAA ACTTCCGTCA AGTCACGTCA TTGTAGCTCC
CTCAATTGTA GGGTCACATA TAATATCTGC TTAACATCAT AGATTCTTAC CATTAGCAGA AAGTGCTATG AATTGCATAT
GAAAATGATT ATGAACCTTG ATTGTAAATG AAATAGTTGC CGTGATTGCC AAGTAGGAGT AGTTTGAAAA GACAAGTATT
TTCAAGAGAA TATAGGTCCT TTAGAGACAC TGTACATACC TAGAAATTTC ATGGAAATTT ATTGGCATAT TTATCTATAT
CCTCATATAC ATGCATATAT ACGGTATACC TGCTTGATTT CATAAAGTAT GGCCTTTTTT TTGGATAAAA GGCCTAAGAT
AGGAGATTGC CTTTGGTATC TAAAAGAGTT GCAAGACAGC ATTTTAACTT GTACATATGT AGCAGAGAGC TGCTAGTTAT
TTACAACAAT TCTACACAAA ATTAAGGTTC ACTCATGTGT ATTTTGATCA TTTTCTGCAG GGCCTTAGAC CAACAATTCC
GAAAGATACG CACCCCAAGC TGTCTGAGCT GCTTCAGAAA TGCTGGCATA GAGATCCTGC TGAAAGGCCT GACTTCTCCC
AGATACTGGA GATTCTTCAG AGACTCCCCA AAGAGGTCAG TTCTAATGCA CCTCGACTCA TCAATTTATC ATGCATTTCT
TAAAAATTCT CAAGATTTTG TTCTTTTACA AAAACAGAAA CTATTTGCTC AATGAAATTT TAGTTTGTTT CATGTTCAAT
ATCATGCTCC AGAAAAATAT ATATTAAATT TTGTTTTAAT ATCCTGATTT AAAAAAACAG GTGAGAGCTG ATACCGAGGG
TCGCCAGAAA TCAAAGGCAG GATTTCTTTC AGCATTGAAG AGAAACCACT GAAAGTAGCT TATACAATGT TGGTGCATCA
TTCAATTGTA GCATCCCACA ACAAGAGGGA AGCGCATTGT GGTGTACAGT GATTAAAAAA AAAGTATTTC TTACGTTGTT
GCAGCTTTGT TTTTTTTGCT TATTTAGTTT TTTTTTCAGC TTTTTGGTTT CTTTTGCTGT TGTTTTTCTT GTTCTAGTTT
TGTTGCATTA ATGAGAACAA GTATAGAAAA AGGAATGTGC TGAAAAGAGT TGTACAAATT GATCC