Os02t0120600-01

Locus

Os02g0120600

Description

Similar to Ubiquitin-conjugating enzyme E2-17 kDa 9 (EC 6.3.2.19) (Ubiquitin- protein ligase 9) (Ubiquitin carrier protein 9) (UBCAT4B).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

UBC13

CGSNL Gene Name

UBIQUITIN-CONJUGATING ENZYME 13

Oryzabase Gene Symbol Synonym(s)

OsUBC13

Oryzabase Gene Name Synonym(s)

Ubiquitin-conjugating enzyme 13

Transcript Evidence

AK120237 (DDBJ, Best hit)

Protein Evidence

B4FSG6 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: acid-amino acid ligase activity (GO:0016881)

Functional domain (InterPro)

Ubiquitin-conjugating enzyme, E2 (IPR000608)

Ubiquitin-conjugating enzyme/RWD-like (IPR016135)

Ubiquitin-conjugating enzyme, active site (IPR023313)

Full-length cDNA

J013043N18 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0120600-01)

RiceXPro (AK120237)

Others

Oryzabase (19560)

KEGG (Os02t0120600-01 (EC:6.3.2.19))

Transcript

812 bp

>Os02t0120600-01 Similar to Ubiquitin-conjugating enzyme E2-17 kDa 9 (EC 6.3.2.19) (Ubiquitin- protein ligase 9) (Ubiquitin carrier protein 9) (UBCAT4B).
ATCGAAACAAAACATTCTTCAGTTGATCTTGAGATTAAGTCACTCCTCCATCCCATCTCA
AGAACTGATCAAGGAAAGGAAAAAAAATGGCACTGAGGAGAATAATCAAGGAGCTCAAGG
ACCTTCAGAGGGATCCGCCGACTTCCTGCAGCGCCGGGCCTGTGTCTGATGACATGTTCC
ACTGGCAAGCAACAATCATGGGGCCCAATGACAGCCCCTACTCTGGAGGAGTGTTCCTGG
TGACCATCCACTTCCCTCCTGACTACCCTTTCAAGCCTCCAAAGGTGGCATTCAAGACCA
AGGTGTTCCATCCAAACATAAACAGCAATGGCAACATCTGCCTTGACATCCTCAAGGACC
AGTGGAGCCCAGCTCTCACCATCTCCAAGGTTCTTCTGTCGATCTGCTCGCTGCTGACGG
ACCCGAACCCGGACGATCCGCTGGTGCCGGAGATCGCTCATATGTGCAAGACTGATCGCC
TCAGATACGAATCCACCGCAAGAGGCTGGACGCAGAAGTACGCCATGGGCTAAGCTTAGC
TGCAAGCTAGCTAATTGCAGCTGAAATGGCAATTGGATTTGGATTTGGATGCAGGGGACA
ATCAGTCAATCACCAGCATGTCGATTAGAATTCAGAAATATAGATCGTGCCATAAAAAAA
GATAGTAATAATTCTTGCTTGCAATTATTAGGATTGTTGTTGCAAATCTGAATCATCGTT
ATCATCTAACCTATAATCAAAAACCATCGTCTTCTTGGTGAGGAGGAATAATAAAAGTCT
GCGATTTTGACGGAATTATTGTTCGTCAGAAG

CDS

447 bp

>Os02t0120600-01 Similar to Ubiquitin-conjugating enzyme E2-17 kDa 9 (EC 6.3.2.19) (Ubiquitin- protein ligase 9) (Ubiquitin carrier protein 9) (UBCAT4B).
ATGGCACTGAGGAGAATAATCAAGGAGCTCAAGGACCTTCAGAGGGATCCGCCGACTTCC
TGCAGCGCCGGGCCTGTGTCTGATGACATGTTCCACTGGCAAGCAACAATCATGGGGCCC
AATGACAGCCCCTACTCTGGAGGAGTGTTCCTGGTGACCATCCACTTCCCTCCTGACTAC
CCTTTCAAGCCTCCAAAGGTGGCATTCAAGACCAAGGTGTTCCATCCAAACATAAACAGC
AATGGCAACATCTGCCTTGACATCCTCAAGGACCAGTGGAGCCCAGCTCTCACCATCTCC
AAGGTTCTTCTGTCGATCTGCTCGCTGCTGACGGACCCGAACCCGGACGATCCGCTGGTG
CCGGAGATCGCTCATATGTGCAAGACTGATCGCCTCAGATACGAATCCACCGCAAGAGGC
TGGACGCAGAAGTACGCCATGGGCTAA

Protein

149 aa

>Os02t0120600-01 Similar to Ubiquitin-conjugating enzyme E2-17 kDa 9 (EC 6.3.2.19) (Ubiquitin- protein ligase 9) (Ubiquitin carrier protein 9) (UBCAT4B).
MALRRIIKELKDLQRDPPTSCSAGPVSDDMFHWQATIMGPNDSPYSGGVFLVTIHFPPDY
PFKPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDPLV
PEIAHMCKTDRLRYESTARGWTQKYAMG*

5'UTR

chr02:1078475..1078560 (+ strand) : 86 bp

CDS

chr02:1078561..1078630 (+ strand) : 70 bp

chr02:1078758..1078885 (+ strand) : 128 bp

chr02:1079016..1079120 (+ strand) : 105 bp

chr02:1079228..1079371 (+ strand) : 144 bp

3'UTR

chr02:1079372..1079650 (+ strand) : 279 bp

FASTA

>Os02t0120600-01 class=Sequence position=chr02:1078475..1079650 (+ strand)
ATCGAAACAA AACATTCTTC AGTTGATCTT GAGATTAAGT CACTCCTCCA TCCCATCTCA AGAACTGATC AAGGAAAGGA
AAAAAAATGG CACTGAGGAG AATAATCAAG GAGCTCAAGG ACCTTCAGAG GGATCCGCCG ACTTCCTGCA GCGCCGGTGA
TACGCAAATC TTTGCATTAC ATCCTGAAAA TCTTCAGATA GAAATGTTCA GAAACAAAAT CAAGAAGATC TATTGCATTA
AATTTTCTCA TTGTTGTTGA TGAATTGGTG AAAATTCAAT CAGGGCCTGT GTCTGATGAC ATGTTCCACT GGCAAGCAAC
AATCATGGGG CCCAATGACA GCCCCTACTC TGGAGGAGTG TTCCTGGTGA CCATCCACTT CCCTCCTGAC TACCCTTTCA
AGCCTCCAAA GGTATGTGCT AACTAAGCAA ACATCACTTG TCTATCATAA TTCAATCAAG ATTCAAGAAG TTGATGAAAC
CCAATCATGA AATGAAAAAT GAAGCGTCTG ATTGACTCAT TGATTGGGAT CTTGGGAGCA GGTGGCATTC AAGACCAAGG
TGTTCCATCC AAACATAAAC AGCAATGGCA ACATCTGCCT TGACATCCTC AAGGACCAGT GGAGCCCAGC TCTCACCATC
TCCAAGGTAA TTAACAACAC AAGAACAACA TCATCATCAG CAGCAGCATT GTGAATTGGT AATGAACTGA TGATGATTAA
TAGTGGATGG TAACTCACTC ATAATTGGTG CAGGTTCTTC TGTCGATCTG CTCGCTGCTG ACGGACCCGA ACCCGGACGA
TCCGCTGGTG CCGGAGATCG CTCATATGTG CAAGACTGAT CGCCTCAGAT ACGAATCCAC CGCAAGAGGC TGGACGCAGA
AGTACGCCAT GGGCTAAGCT TAGCTGCAAG CTAGCTAATT GCAGCTGAAA TGGCAATTGG ATTTGGATTT GGATGCAGGG
GACAATCAGT CAATCACCAG CATGTCGATT AGAATTCAGA AATATAGATC GTGCCATAAA AAAAGATAGT AATAATTCTT
GCTTGCAATT ATTAGGATTG TTGTTGCAAA TCTGAATCAT CGTTATCATC TAACCTATAA TCAAAAACCA TCGTCTTCTT
GGTGAGGAGG AATAATAAAA GTCTGCGATT TTGACGGAAT TATTGTTCGT CAGAAG

Locus: Os02g0120600

Loading...

Locus: Os02g0120600

Loading...