Os02t0120800-02

Locus

Os02g0120800

Description

Similar to Small GTP-binding protein (Fragment).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RAC6

CGSNL Gene Name

RAC/ROP-TYPE GTPASE 6

Oryzabase Gene Symbol Synonym(s)

OsRacB, RacB, OsRac6

Oryzabase Gene Name Synonym(s)

Rac-like GTP-binding protein 6, GTPase protein RacB

Transcript Evidence

AK069443 (DDBJ, Best hit)

Protein Evidence

NP_001105197.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: GTP catabolic process (GO:0006184)

Biological Process: signal transduction (GO:0007165)

Biological Process: small GTPase mediated signal transduction (GO:0007264)

Biological Process: protein transport (GO:0015031)

Cellular Component: intracellular (GO:0005622)

Cellular Component: membrane (GO:0016020)

Molecular Function: GTPase activity (GO:0003924)

Molecular Function: GTP binding (GO:0005525)

Functional domain (InterPro)

Small GTPase superfamily (IPR001806)

Small GTPase superfamily, Rho type (IPR003578)

Small GTPase superfamily, Rab type (IPR003579)

Small GTP-binding protein domain (IPR005225)

Small GTPase superfamily, Ras type (IPR020849)

Full-length cDNA

J023024G13 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0120800-02)

RiceXPro (AK069443)

Others

Oryzabase (6293)

KEGG (Os02t0120800-02)

Transcript

1101 bp

>Os02t0120800-02 Similar to Small GTP-binding protein (Fragment).
GAGAGAGAgagagagagagagagagagagagaggggggagcggtcgcaggaggaggagga
cggcggcgtctgctgcgaccgacggggagcggcgaggatgagcgcgtccaggttcataaa
gtgcgtcaccgtcggggacggcgccgtcggcaagacCTGCATGCTCATCTCCTACACCTC
CAACACCTTCCCCACTGATTATGTTCCGACGGTGTTTGACAACTTCAGTGCCAACGTCGT
GGTTGATGGTAACACCGTCAACCTCGGGCTATGGGACACTGCAGGTCAGGAGGATTACAA
CAGACTGAGACCACTGAGTTATCGTGGAGCTGATGTTTTCCTTCTGGCCTTCTCGCTAAT
CAGCAAGGCCAGCTATGAGAATGTTTCAAAGAAGTGGATACCTGAGCTGAAGCATTATGC
ACCTGGTGTGCCTATCATCCTTGTGGGAACAAAGCTTGATCTTCGAGATGACAAGCAGTT
TTTTGTGGACCATCCTGGTGCTGTTCCTATCACCACTGCTCAGGGAGAGGAACTAAGAAA
GCAAATAGGCGCCCCATACTACATCGAATGCAGCTCAAAGACCCAACTAAACGTCAAGGG
CGTTTTCGATGCGGCAATAAAGGTGGTGCTGCAGCCACCCAAGGCGAAGAAGAAGAAAAA
GGCGCAAAGGGGGGCGTGCTCCATTTTGTGATCTAATCATCAGTAGACGACGAAGAAGAA
GAACGATGAAGTTGCCAGGCTTTATTATTGTTGCGTCTTGCTTCAGCGAAACAGCATTCA
TGGTCCGGGGATCCTAGTTTACTGGCAGCTGCAGCAAGGCCTCTTTGTCGAGGCAATGAG
CGATCCGTTTGTTTCATTTTCTCCTTTCTGCCTTGTGATTATCTCGTGTGACTGACAAGT
CGTGGCAATTAGGTAACTTTCCTAGATGGTATTTCCTGTGTTTGAGAAAAAAAATTCTTG
TTATCCCTGTTTCATAAGTAGACATGATGTAATCGCACTCAGTTTATTCTTTTCCTTCTT
ATTTCACTTCAATGGAAAATTATGTTTCCCCTTCATATTCTGTTCTGCAAATGGAGCAAG
ATCTGTGATGTTCTTCTGACT

CDS

594 bp

>Os02t0120800-02 Similar to Small GTP-binding protein (Fragment).
atgagcgcgtccaggttcataaagtgcgtcaccgtcggggacggcgccgtcggcaagacC
TGCATGCTCATCTCCTACACCTCCAACACCTTCCCCACTGATTATGTTCCGACGGTGTTT
GACAACTTCAGTGCCAACGTCGTGGTTGATGGTAACACCGTCAACCTCGGGCTATGGGAC
ACTGCAGGTCAGGAGGATTACAACAGACTGAGACCACTGAGTTATCGTGGAGCTGATGTT
TTCCTTCTGGCCTTCTCGCTAATCAGCAAGGCCAGCTATGAGAATGTTTCAAAGAAGTGG
ATACCTGAGCTGAAGCATTATGCACCTGGTGTGCCTATCATCCTTGTGGGAACAAAGCTT
GATCTTCGAGATGACAAGCAGTTTTTTGTGGACCATCCTGGTGCTGTTCCTATCACCACT
GCTCAGGGAGAGGAACTAAGAAAGCAAATAGGCGCCCCATACTACATCGAATGCAGCTCA
AAGACCCAACTAAACGTCAAGGGCGTTTTCGATGCGGCAATAAAGGTGGTGCTGCAGCCA
CCCAAGGCGAAGAAGAAGAAAAAGGCGCAAAGGGGGGCGTGCTCCATTTTGTGA

Protein

198 aa

>Os02t0120800-02 Similar to Small GTP-binding protein (Fragment).
MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD
TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELKHYAPGVPIILVGTKL
DLRDDKQFFVDHPGAVPITTAQGEELRKQIGAPYYIECSSKTQLNVKGVFDAAIKVVLQP
PKAKKKKKAQRGACSIL*

5'UTR

chr02:1083856..1083952 (- strand) : 97 bp

CDS

chr02:1083757..1083855 (- strand) : 99 bp

chr02:1082591..1082678 (- strand) : 88 bp

chr02:1082398..1082507 (- strand) : 110 bp

chr02:1081938..1082001 (- strand) : 64 bp

chr02:1081306..1081370 (- strand) : 65 bp

chr02:1081111..1081176 (- strand) : 66 bp

chr02:1080923..1081024 (- strand) : 102 bp

3'UTR

chr02:1080513..1080922 (- strand) : 410 bp

FASTA

>Os02t0120800-02 class=Sequence position=chr02:1080513..1083952 (- strand)
GAGAGAGAga gagagagaga gagagagaga gaggggggag cggtcgcagg aggaggagga cggcggcgtc tgctgcgacc
gacggggagc ggcgaggatg agcgcgtcca ggttcataaa gtgcgtcacc gtcggggacg gcgccgtcgg caagacCTGC
ATGCTCATCT CCTACACCTC CAACACCTTC CCCACTGTGC GTATTCTTCT TCTTCTTCTT CTTCTTCTTC CTCCAAACAT
TTCCTTTTCT TCTTCTTCTT CTTTCTTTTG CTTCTTCTTT TTTTAATTAT TTTTGAAAAA AAATACTTGT GTGCTCGGAG
GCTTGGAGCT AGGATTATGG TTCTTGATCT GGATTTGGGC CCAAATTGTG GGGCTTTTCT GATTCGTCCG CCGCTCGTGA
ATTTGGGACA ATGCGGCTTC GAATTCCTGC CTAGGGTTGC CATTCGAGTT TGAGTAAAAA GGGGATCTTT TGCACGGCAC
CCCGTACCAA ATCAAAAACC GTGGCTCAAA TCGAAGCCAA ATGCTGCCTC ATTCGTTCCT CGTGAACGCT CAAACAAAAA
AAATGCAGTA GAAAAACAAA AAATTCGTCC TTGATTGCTT GCAGCATTTA TGGATTGTAG CAGCATTAGC GGCGGAAAAA
AATGCAGGTT TTTTCCCCCC ACGATTCATA TAACGTCGAA TCAGTTTGGC TGGCGTTTCT CTATCAAAGG TGGGAAACCG
CGGATCCGCC AGGTCGAGAG CTCGATATCG CTTTCCCGAC TTTCTAGTTG TCCTGTACCC TCCTCCACTC ACATCTCACA
CCTTCCCCAT GGTTGGTAAG CGCATTCTTT GTTCCTTTCA CGCAAATCCA CACCCAATCA ATTACACACC ACCACCCTTG
CTTTTCGCGC ATGGTTAATT TCCCAATTGC ACATTAATTT CCCTCTTTTG AGGAGAGATC TTCAAAAGAA GAGAACATTT
CAGCTGCTTT GGGGGGTAGA TTAGCTTATT AGAGCCCTGA GACATGGTGA CCATGTAGTG GGGGTAGTGT ATCCATTGGA
CCACCTGTGG ACTTCTTGCC ATGTATAATA GGCCTGGTAA AATAGTAATC TAGTGGAGTA TATATCAGTT TTGTAATCTT
ATCTTTAGGC AAGAGTTTGA GAATGGACTG CACATTTACC ATAGATATCT TATCAGTTCT GTAACAGTAG GATTCACCTC
ATTTTGTATC TTATGAATCG GTTGTGCCTT GAGACGATAT GTGCACTCAT TGTTCGCGTC ATTGCTTTTG ACAGGATTAT
GTTCCGACGG TGTTTGACAA CTTCAGTGCC AACGTCGTGG TTGATGGTAA CACCGTCAAC CTCGGGCTAT GGGACACTGC
AGGTAATCTG GTTGCGCTGC TATCTAATTC TGCATGCTTG TTTTCTTCTA CCAAGTTATT AAGTTTTTCC TTCGGAATAC
CACAGGTCAG GAGGATTACA ACAGACTGAG ACCACTGAGT TATCGTGGAG CTGATGTTTT CCTTCTGGCC TTCTCGCTAA
TCAGCAAGGC CAGCTATGAG AATGTTTCAA AGAAGGCAAG GGACTCACTT TCATTTTCTG TTAATAATAT TGATGTGCTC
TTTTTTTCTT CTTTCGCTAA AGAAGTTTGT TGGTCATGTT TAATTTGAGA TCGTCTGTGC AATGATATGT TGCTTCTGGC
ATTTTTCTTG TGTTTTTGCC TTCTTCGATG ATAAAACTAT TACCATGCTG GGAATTAGGC TCCACAAAAT TTAGAGCAGG
CCTAGATGCA TCCTTCAATG GATTATTCCA CCCATTAGAG ATGATAGATG ATGATAATAA TCTCATAAAT TTATGTTCAT
AGGTCATTGT CTTATGTTGA TACTTGATTT GATCATTTTT GTGGCTCGAT TCACTTTTTT AGTCTCCACT TATGGTACTT
CTTGTTGATT CTAAACTTTG TTATATTTCA GTGGATACCT GAGCTGAAGC ATTATGCACC TGGTGTGCCT ATCATCCTTG
TGGGAACAAA GCTTGGTAAG AACCGTGCAA GGCTCTATTT TGAGAAATCT AATCTTTTGT ACCTGTCACA AGTTCGGTTT
TGATTTTGGA TGGAAGTAGT GGCATGGGAT TTTTAGGTTG ATACGATTTT ATTTGGTGTG TGTTCTTTTG ATGTCAATGC
TTGGTACTGG TGACGTCATT TAGTGATAAT ACATGAAGCA GGGTGCTCTA TAAAAGAGGA AAAATATGGA TATATAGTAC
CAGTATATCA ATCAGCCATA GTTTTTAGTA CTTGCAAGAA ATTCTTGTGA TAAACCTATT TGAACTGTTT GCTCTTTTGG
TTCTACTTTT GTACTATTCA ACTTTGGTTC AACAACATGC AACAGTTATA CTCTGTCTCA CAGATTTGTG GCATTGCACG
TTGTCCCTCA GTTTGCTATT GTCATGATGG ATTCAGTTTT GTTGTCTTTT TTTTTTTGGC TGGTGTTTCT ACCTGTCTTA
TGAAATTAAA TTCCAATCAT TCTACAGATA ATATCCCCTT CGACCTGTAA AGATCCAACT GTAGCCCACT TACATTTTTC
ACATTGTTTA TTGCACTGGC AGATCTTCGA GATGACAAGC AGTTTTTTGT GGACCATCCT GGTGCTGTTC CTATCACCAC
TGCTCAGGTA CAGTTGTGGC ATTGTGGGTT GTTTAATTCC TTATTTACTG TAGCATCAGA GATGTACTTG CAACTCCTGT
GGACTACATT GCCATATCTT GATCATTTTT TTGTTCCTTA ATTGCCACTT TTGTAGGGAG AGGAACTAAG AAAGCAAATA
GGCGCCCCAT ACTACATCGA ATGCAGCTCA AAGACCCAAC TAGTACTGCT TTCTTCCCAT TTCTTTGCTA AATGTGCAAT
AACATATAAG ATACTAACAG AGATATCCTG CCCCCCCCTG ATCTGCAGAA CGTCAAGGGC GTTTTCGATG CGGCAATAAA
GGTGGTGCTG CAGCCACCCA AGGCGAAGAA GAAGAAAAAG GCGCAAAGGG GGGCGTGCTC CATTTTGTGA TCTAATCATC
AGTAGACGAC GAAGAAGAAG AACGATGAAG TTGCCAGGCT TTATTATTGT TGCGTCTTGC TTCAGCGAAA CAGCATTCAT
GGTCCGGGGA TCCTAGTTTA CTGGCAGCTG CAGCAAGGCC TCTTTGTCGA GGCAATGAGC GATCCGTTTG TTTCATTTTC
TCCTTTCTGC CTTGTGATTA TCTCGTGTGA CTGACAAGTC GTGGCAATTA GGTAACTTTC CTAGATGGTA TTTCCTGTGT
TTGAGAAAAA AAATTCTTGT TATCCCTGTT TCATAAGTAG ACATGATGTA ATCGCACTCA GTTTATTCTT TTCCTTCTTA
TTTCACTTCA ATGGAAAATT ATGTTTCCCC TTCATATTCT GTTCTGCAAA TGGAGCAAGA TCTGTGATGT TCTTCTGACT