Os02t0122700-00

Locus

Os02g0122700

Description

Similar to SET domain protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsSET7, SDG730, OsPHD8, PHD8

Oryzabase Gene Name Synonym(s)

SET protein 7, Plant homeo-domain finger protein 8, PHD finger protein 8

Transcript Evidence

ab initio prediction

Protein Evidence

XP_002318442.1 (RefSeq)

Literature

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Molecular Function: zinc ion binding (GO:0008270)

Functional domain (InterPro)

SET domain (IPR001214)

Zinc finger, PHD-type (IPR001965)

Zinc finger, FYVE/PHD-type (IPR011011)

Zinc finger, RING/FYVE/PHD-type (IPR013083)

Zinc finger, PHD-type, conserved site (IPR019786)

Zinc finger, PHD-finger (IPR019787)

Expression Databases

TENOR (Os02t0122700-00)

Others

Oryzabase (13375)

Transcript

876 bp

>Os02t0122700-00 Similar to SET domain protein.
ATGGGGCCCGCGACGCCGCTGCGCCGCCGGACGAGGGCGCGGCCGGCCGCCACCAGGGCG
GAGGGCGGCAGCGGCGGCGACGGCGACGACGACGACGTTCGCTGCGAGGCGTGCGGGTCC
GGGGAGTCGGCGGCGGAGCTGCTGCTGTGCGATGGCTGCGACCGTGGCCTCCACATCTTC
TGCCTCCGCCCCATCCTCCCGCGCGTCCCCGCCGGCGACTGGTTCTGCCCCTCCTGCGCC
TCGCCGTCGCCGCACTCCAAGAAATCACACGCGGCCAAGAAGCCCAAGCAGTTCCCGCTG
GTCCAGACGAAGATCGTGGATTTCTTCAAGATCCAGAGGGGCCCGGCGGCGGCGCTGGCG
GCGGCGGCGGAGTCGTCGGAGGGGAAGAAGAGGAAGCGGAAGGTGCTACCAAAGGAGGAC
GTCGAGACGCTGAATCTGTGCAAGAGGATGATGGCGAGAGGCGAGTGGCCGCCTCTCCTC
GTCGTCTACGACCCCGTCGAGGGGTTCACCGTGGAGGCGGACAGGTTCATCAAGGATCTC
ACCATCATCACCGAGTACGTCGGCGACGTCGACTACCTGACCCGCCGCGAGCACGACGAC
GGCGACAGCATGATGACCCTGCTGTCGGCGGCCACGCCGTCGAGGAGCCTCGTCATCTGC
CCCGACAAGCGGAGCAACATCGCTCGCTTCATCAATGGCATCAACAACCACACTCCAGAT
GGCCGGAAGAAGCAGAATCTCAAGTGCGTCCGCTTCGACGTCGGCGGCGAGTGCCGGGTG
CTCTTGGTGGCGAACAGGGACATCTCCAAAGGGGAGAGGCTGTACTACGATTACAATGGA
TCGGAGCATGAGTACCCAACCCACCATTTTGTATGA

CDS

876 bp

>Os02t0122700-00 Similar to SET domain protein.
ATGGGGCCCGCGACGCCGCTGCGCCGCCGGACGAGGGCGCGGCCGGCCGCCACCAGGGCG
GAGGGCGGCAGCGGCGGCGACGGCGACGACGACGACGTTCGCTGCGAGGCGTGCGGGTCC
GGGGAGTCGGCGGCGGAGCTGCTGCTGTGCGATGGCTGCGACCGTGGCCTCCACATCTTC
TGCCTCCGCCCCATCCTCCCGCGCGTCCCCGCCGGCGACTGGTTCTGCCCCTCCTGCGCC
TCGCCGTCGCCGCACTCCAAGAAATCACACGCGGCCAAGAAGCCCAAGCAGTTCCCGCTG
GTCCAGACGAAGATCGTGGATTTCTTCAAGATCCAGAGGGGCCCGGCGGCGGCGCTGGCG
GCGGCGGCGGAGTCGTCGGAGGGGAAGAAGAGGAAGCGGAAGGTGCTACCAAAGGAGGAC
GTCGAGACGCTGAATCTGTGCAAGAGGATGATGGCGAGAGGCGAGTGGCCGCCTCTCCTC
GTCGTCTACGACCCCGTCGAGGGGTTCACCGTGGAGGCGGACAGGTTCATCAAGGATCTC
ACCATCATCACCGAGTACGTCGGCGACGTCGACTACCTGACCCGCCGCGAGCACGACGAC
GGCGACAGCATGATGACCCTGCTGTCGGCGGCCACGCCGTCGAGGAGCCTCGTCATCTGC
CCCGACAAGCGGAGCAACATCGCTCGCTTCATCAATGGCATCAACAACCACACTCCAGAT
GGCCGGAAGAAGCAGAATCTCAAGTGCGTCCGCTTCGACGTCGGCGGCGAGTGCCGGGTG
CTCTTGGTGGCGAACAGGGACATCTCCAAAGGGGAGAGGCTGTACTACGATTACAATGGA
TCGGAGCATGAGTACCCAACCCACCATTTTGTATGA

Protein

292 aa

>Os02t0122700-00 Similar to SET domain protein.
MGPATPLRRRTRARPAATRAEGGSGGDGDDDDVRCEACGSGESAAELLLCDGCDRGLHIF
CLRPILPRVPAGDWFCPSCASPSPHSKKSHAAKKPKQFPLVQTKIVDFFKIQRGPAAALA
AAAESSEGKKRKRKVLPKEDVETLNLCKRMMARGEWPPLLVVYDPVEGFTVEADRFIKDL
TIITEYVGDVDYLTRREHDDGDSMMTLLSAATPSRSLVICPDKRSNIARFINGINNHTPD
GRKKQNLKCVRFDVGGECRVLLVANRDISKGERLYYDYNGSEHEYPTHHFV*

CDS

chr02:1190846..1191134 (+ strand) : 289 bp

chr02:1191235..1191347 (+ strand) : 113 bp

chr02:1191645..1191958 (+ strand) : 314 bp

chr02:1192302..1192461 (+ strand) : 160 bp

FASTA

>Os02t0122700-00 class=Sequence position=chr02:1190846..1192461 (+ strand)
ATGGGGCCCG CGACGCCGCT GCGCCGCCGG ACGAGGGCGC GGCCGGCCGC CACCAGGGCG GAGGGCGGCA GCGGCGGCGA
CGGCGACGAC GACGACGTTC GCTGCGAGGC GTGCGGGTCC GGGGAGTCGG CGGCGGAGCT GCTGCTGTGC GATGGCTGCG
ACCGTGGCCT CCACATCTTC TGCCTCCGCC CCATCCTCCC GCGCGTCCCC GCCGGCGACT GGTTCTGCCC CTCCTGCGCC
TCGCCGTCGC CGCACTCCAA GAAATCACAC GCGGCCAAGA AGCCCAAGCG TGAGTAGCCG ATGATGCAAG AACGGATACC
ATTTCCTCTC GCCGAATTCG AACGAATTTC GGTTGGATTT TGAGATTCAC TCTGCTTCTC TTCCTGCAGA GTTCCCGCTG
GTCCAGACGA AGATCGTGGA TTTCTTCAAG ATCCAGAGGG GCCCGGCGGC GGCGCTGGCG GCGGCGGCGG AGTCGTCGGA
GGGGAAGAAG AGGAAGCGGA AGGTGGGTGG CATCCGCTTG GTCTCCAAGA AGAAGAGGAA GCTTCTCCCC TTCAACCCCA
GCGACGACCC GGCGAGGCGC CTCCGCCAGA TGGCGTCgct cgccacggcg ctcaccgcca ccggcgccgt cttcagcaac
gagctcacct acgtccccgg catggctccc cgcgccgcca accgcgccgc cctcGAATCC GGCGGAATGC AGGTCACCTC
CGACCCCGCC CCAAATTCCA AATCGCCCAT CTCGTCGCCT CCTCGTCGCT GCTAAATCTC GCCGCCATTT TCGTCTCAGG
TGCTACCAAA GGAGGACGTC GAGACGCTGA ATCTGTGCAA GAGGATGATG GCGAGAGGCG AGTGGCCGCC TCTCCTCGTC
GTCTACGACC CCGTCGAGGG GTTCACCGTG GAGGCGGACA GGTTCATCAA GGATCTCACC ATCATCACCG AGTACGTCGG
CGACGTCGAC TACCTGACCC GCCGCGAGCA CGACGACGGC GACAGCATGA TGACCCTGCT GTCGGCGGCC ACGCCGTCGA
GGAGCCTCGT CATCTGCCCC GACAAGCGGA GCAACATCGC TCGCTTCATC AATGGCATCA ACAACCACAC TCCGTAAGCA
TCTCACACtg aaagcatatg tgagtcaaca cgatgattag attgatcacg gacacaagta catataggga cggtacatcc
ttatctctat aaccgactta tagatacaga attgggatag gattacggaa accgaaccgg atacaataca aacacccccg
cagttggaac gtgtatggaa cgaacgttca aactggaacg gaactcacaa accgcctggc ccttgcagaa TTTTTGCCAC
ATTGCAAATT CAGAGCAGCA GTAGCAGTAG CAGTAGCAGC ATTGGGAATT TGGGATCATT GTTGCCTGAA AGAAACATAT
CTTGTTGTGC TTGCAGAGAT GGCCGGAAGA AGCAGAATCT CAAGTGCGTC CGCTTCGACG TCGGCGGCGA GTGCCGGGTG
CTCTTGGTGG CGAACAGGGA CATCTCCAAA GGGGAGAGGC TGTACTACGA TTACAATGGA TCGGAGCATG AGTACCCAAC
CCACCATTTT GTATGA

Locus: Os02g0122700

Loading...

Locus: Os02g0122700

Loading...