Os02t0125600-00

Locus

Os02g0125600

Description

Plant neutral invertase family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

NIN5

CGSNL Gene Name

NEUTRAL/ALKALINE INVERTASE 5

Oryzabase Gene Symbol Synonym(s)

OsNIN5

Oryzabase Gene Name Synonym(s)

neutral/alkaline invertase 5

Transcript Evidence

AY575562 (DDBJ, Best hit)

Protein Evidence

D5LY31 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: catalytic activity (GO:0003824)

Functional domain (InterPro)

Plant neutral invertase (IPR006937)

Six-hairpin glycosidase-like (IPR008928)

Expression Databases

TENOR (Os02t0125600-00)

Others

Oryzabase (14670)

KEGG (Os02t0125600-00)

Transcript

697 bp

>Os02t0125600-00 Plant neutral invertase family protein.
CCTGACTGGATATTCGACTTCATGCCCAGCCGCGGCGGGTACTTCATCGGCAACGTCAGC
CCTGCGAGGATGGACTTCCGCTGGTTCTGCCTGGGCAACTTCATCGCGATCCTCTCCTCG
CTGACAACCGGAGAACAGGCTGAAGCAATCCTGGACCTTGTGGAGGAGCGCTGGGAGGAG
CTCATCGGAGAGATGCCCATGAAGGTGTGTTACCCCGCGATGGAGAACCAGGAGTGGCAG
ATCGTCACCGGGTGCGACCCCAAGAACACCAGATGGAGCTACCACAATGGAGGATCATGG
CCAGTGTTGCTGTGGCTGCTGGTGGCGGTGAGCGTGAAGCTGGGGCGGCCACACATCGCG
AGGCGGGCGGTGGAGGTGATGGAGAAGCGGCTGGTGAAGGACGAGTTCCCGGAGTACTAC
GACGGGAAGGCCGGGAGGTACGTGGGGAAGCAAGCGCGCAAGTTCCAgacgtggtccgtg
gccggctacctggtcgccaagatgctcctcgacgacccctccaacctccgcgccgtctcc
ctcgccgacgactgccaCATCCGCTCCGCCCCCGTCCTCAAGCGCAGCAACTCCTTCCCG
TGATGATCAACACAATGCTCAAACTAAGCTCACACCGCACTTCACATATACTCACCACCA
CCACGTAATTAACGCTGCCTCGCTGTTAATGTTCTTA

CDS

603 bp

>Os02t0125600-00 Plant neutral invertase family protein.
CCTGACTGGATATTCGACTTCATGCCCAGCCGCGGCGGGTACTTCATCGGCAACGTCAGC
CCTGCGAGGATGGACTTCCGCTGGTTCTGCCTGGGCAACTTCATCGCGATCCTCTCCTCG
CTGACAACCGGAGAACAGGCTGAAGCAATCCTGGACCTTGTGGAGGAGCGCTGGGAGGAG
CTCATCGGAGAGATGCCCATGAAGGTGTGTTACCCCGCGATGGAGAACCAGGAGTGGCAG
ATCGTCACCGGGTGCGACCCCAAGAACACCAGATGGAGCTACCACAATGGAGGATCATGG
CCAGTGTTGCTGTGGCTGCTGGTGGCGGTGAGCGTGAAGCTGGGGCGGCCACACATCGCG
AGGCGGGCGGTGGAGGTGATGGAGAAGCGGCTGGTGAAGGACGAGTTCCCGGAGTACTAC
GACGGGAAGGCCGGGAGGTACGTGGGGAAGCAAGCGCGCAAGTTCCAgacgtggtccgtg
gccggctacctggtcgccaagatgctcctcgacgacccctccaacctccgcgccgtctcc
ctcgccgacgactgccaCATCCGCTCCGCCCCCGTCCTCAAGCGCAGCAACTCCTTCCCG
TGA

Protein

201 aa

>Os02t0125600-00 Plant neutral invertase family protein.
PDWIFDFMPSRGGYFIGNVSPARMDFRWFCLGNFIAILSSLTTGEQAEAILDLVEERWEE
LIGEMPMKVCYPAMENQEWQIVTGCDPKNTRWSYHNGGSWPVLLWLLVAVSVKLGRPHIA
RRAVEVMEKRLVKDEFPEYYDGKAGRYVGKQARKFQTWSVAGYLVAKMLLDDPSNLRAVS
LADDCHIRSAPVLKRSNSFP*

CDS

chr02:1343281..1343584 (+ strand) : 304 bp

chr02:1343691..1343989 (+ strand) : 299 bp

3'UTR

chr02:1343990..1344083 (+ strand) : 94 bp

FASTA

>Os02t0125600-00 class=Sequence position=chr02:1343281..1344083 (+ strand)
CCTGACTGGA TATTCGACTT CATGCCCAGC CGCGGCGGGT ACTTCATCGG CAACGTCAGC CCTGCGAGGA TGGACTTCCG
CTGGTTCTGC CTGGGCAACT TCATCGCGAT CCTCTCCTCG CTGACAACCG GAGAACAGGC TGAAGCAATC CTGGACCTTG
TGGAGGAGCG CTGGGAGGAG CTCATCGGAG AGATGCCCAT GAAGGTGTGT TACCCCGCGA TGGAGAACCA GGAGTGGCAG
ATCGTCACCG GGTGCGACCC CAAGAACACC AGATGGAGCT ACCACAATGG AGGATCATGG CCAGGTACGT ACGTACTATA
GCAGTATAAT CTCCAAATGT TGTGCATCGA TCTGCAGCTG TTTCTTGTGG ATGACAATCA TAATTGATTG GAATGATGAT
GATGGATCAG TGTTGCTGTG GCTGCTGGTG GCGGTGAGCG TGAAGCTGGG GCGGCCACAC ATCGCGAGGC GGGCGGTGGA
GGTGATGGAG AAGCGGCTGG TGAAGGACGA GTTCCCGGAG TACTACGACG GGAAGGCCGG GAGGTACGTG GGGAAGCAAG
CGCGCAAGTT CCAgacgtgg tccgtggccg gctacctggt cgccaagatg ctcctcgacg acccctccaa cctccgcgcc
gtctccctcg ccgacgactg ccaCATCCGC TCCGCCCCCG TCCTCAAGCG CAGCAACTCC TTCCCGTGAT GATCAACACA
ATGCTCAAAC TAAGCTCACA CCGCACTTCA CATATACTCA CCACCACCAC GTAATTAACG CTGCCTCGCT GTTAATGTTC
TTA

Locus: Os02g0125600

Loading...

Locus: Os02g0125600

Loading...