Os02t0128600-01

Locus

Os02g0128600

Description

Similar to ADP-ribosylation factor-like protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ARFB1B

CGSNL Gene Name

ADP-RIBOSYLATION FACTOR B1B

Oryzabase Gene Symbol Synonym(s)

OsARFB1b, ARFB1b

Oryzabase Gene Name Synonym(s)

ADP-ribosylation factor B1b

Transcript Evidence

AK059865 (DDBJ, Best hit)

AK103009 (DDBJ, Best hit)

Protein Evidence

B6TGE5 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: intracellular protein transport (GO:0006886)

Biological Process: small GTPase mediated signal transduction (GO:0007264)

Cellular Component: intracellular (GO:0005622)

Molecular Function: GTP binding (GO:0005525)

Functional domain (InterPro)

Small GTP-binding protein domain (IPR005225)

Small GTPase superfamily, SAR1-type (IPR006687)

Small GTPase superfamily, ARF/SAR type (IPR006689)

Small GTPase superfamily, ARF type (IPR024156)

Full-length cDNA

006-207-D04 (Online Clone Ordering)

J033116J07 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0128600-01)

RiceXPro (AK059865)

Others

Oryzabase (21008)

KEGG (Os02t0128600-01)

Transcript

1135 bp

>Os02t0128600-01 Similar to ADP-ribosylation factor-like protein.
ACAGAGAATACTTGCGAGCTCCGATCTCTTCTTCTTCTTCGTGAGCTCTCACCAAACCAA
CCCCAACCACTGCCCTCCTCCTGCCGCGATCCACTCCTGCTCTCCAGCTCAGGGAATCCA
CCTCCACCCGCAGAGACCAACCAGCAGCTGTCCGTCCTCTGCGGCGGCGGCGGCGGCGGC
GAGATGGGGCAAGCTCTGCGGCGGCTCTTCGACGCCTTCTTCTCCACCAGGGAGATGCGG
GTTGTGATGCTTGGTTTGGATGCAGCTGGCAAGACAACAATTTTGTATAGGCTGCACATG
GGAGAAGTTCTTTCAACGGTTCCTACAGTAGGTTTTAACGTAGAGAAGGTTCAGTACAAG
AATGTGGTATTTACTGTGTGGGATGTTGGCGGACAAGAAAAGCTCAGGCCATTATGGAAG
ATGTACCTCAGCAATTCTGATGCACTGATCTACGTTGTTGATTCATTGGACAGAGAAAGG
ATTATAGACGCCAGACAAGAATTTCAGACCATTATCAAGGACCCACTGATGGCAAACAGC
ATAATCTTAGTATTTGCAAACAAACAGGACCTGAGAGGTGCGATGAGCCCAGATGAGGTG
AGCGAGGGGCTAGGCCTGCACGACCTCAGGAACAGGATATGGCATATACAAGGGACATGC
GCTCTCCGTGGTGAGGGACTCTACGATGGACTTGATTGGCTCGCATCCACCCTGAAGCAA
TTGCAAGAGACAGGCCATGCAACTTCAGTCGCCGGCCCTTCCATCTGATTTCGCTAGAGA
AGAGATGCCAATGCCTCAACTAGTCAACCAATCTGATGCTCCTGGGCAGTCATCCTTCTG
TTCATCCAATGAGAATATTGAGTTCCTTGGTGCATGCGTGATCTTCGCTATCGGCTTTCT
TGGTGTGGCTGCTCGCAGAGGAGGGCATTCAATCGCTGTGTTCATATGAGCAAACTCATT
TGACAGTAACTTGCGGCATAATTTTCTCCTAAAATGTTTGTAAAGTGTTTGGACGTCTGT
GTACTTTGTTGTAGTGAACAAGAGCTGAGTAGTTTGCACGGACCGTGCTTGTGTATACTT
GATGGCACGTCCACATGATTGTTTGCTGATTGCCTATCAATAAGACGGTTGGATG

CDS

585 bp

>Os02t0128600-01 Similar to ADP-ribosylation factor-like protein.
ATGGGGCAAGCTCTGCGGCGGCTCTTCGACGCCTTCTTCTCCACCAGGGAGATGCGGGTT
GTGATGCTTGGTTTGGATGCAGCTGGCAAGACAACAATTTTGTATAGGCTGCACATGGGA
GAAGTTCTTTCAACGGTTCCTACAGTAGGTTTTAACGTAGAGAAGGTTCAGTACAAGAAT
GTGGTATTTACTGTGTGGGATGTTGGCGGACAAGAAAAGCTCAGGCCATTATGGAAGATG
TACCTCAGCAATTCTGATGCACTGATCTACGTTGTTGATTCATTGGACAGAGAAAGGATT
ATAGACGCCAGACAAGAATTTCAGACCATTATCAAGGACCCACTGATGGCAAACAGCATA
ATCTTAGTATTTGCAAACAAACAGGACCTGAGAGGTGCGATGAGCCCAGATGAGGTGAGC
GAGGGGCTAGGCCTGCACGACCTCAGGAACAGGATATGGCATATACAAGGGACATGCGCT
CTCCGTGGTGAGGGACTCTACGATGGACTTGATTGGCTCGCATCCACCCTGAAGCAATTG
CAAGAGACAGGCCATGCAACTTCAGTCGCCGGCCCTTCCATCTGA

Protein

195 aa

>Os02t0128600-01 Similar to ADP-ribosylation factor-like protein.
MGQALRRLFDAFFSTREMRVVMLGLDAAGKTTILYRLHMGEVLSTVPTVGFNVEKVQYKN
VVFTVWDVGGQEKLRPLWKMYLSNSDALIYVVDSLDRERIIDARQEFQTIIKDPLMANSI
ILVFANKQDLRGAMSPDEVSEGLGLHDLRNRIWHIQGTCALRGEGLYDGLDWLASTLKQL
QETGHATSVAGPSI*

5'UTR

chr02:1476346..1476528 (+ strand) : 183 bp

CDS

chr02:1476529..1476585 (+ strand) : 57 bp

chr02:1477207..1477297 (+ strand) : 91 bp

chr02:1478247..1478362 (+ strand) : 116 bp

chr02:1478834..1478893 (+ strand) : 60 bp

chr02:1479000..1479065 (+ strand) : 66 bp

chr02:1479571..1479765 (+ strand) : 195 bp

3'UTR

chr02:1479766..1479779 (+ strand) : 14 bp

chr02:1479881..1480233 (+ strand) : 353 bp

FASTA

>Os02t0128600-01 class=Sequence position=chr02:1476346..1480233 (+ strand)
ACAGAGAATA CTTGCGAGCT CCGATCTCTT CTTCTTCTTC GTGAGCTCTC ACCAAACCAA CCCCAACCAC TGCCCTCCTC
CTGCCGCGAT CCACTCCTGC TCTCCAGCTC AGGGAATCCA CCTCCACCCG CAGAGACCAA CCAGCAGCTG TCCGTCCTCT
GCGGCGGCGG CGGCGGCGGC GAGATGGGGC AAGCTCTGCG GCGGCTCTTC GACGCCTTCT TCTCCACCAG GGAGATGCGG
GTACCGTGCG ATCCTCACCC ACATCCTCTC TCCCGCGGTT CTCCTTTGCT TCGTGTGTGG TTCTTGGCCG GAATGGGTGA
TTGATTCCTC CTGCCGCCCT GCCCCTGTGG CTGGGATTCT TGCCTAGGGT TTTCTTGTTG AACTTATTTA TTATTATACC
TAGGAGCTGA AATCTCGACT GTGCAAGAAA TAGGTTGAAT TTTCAGTGGT AGGTAATTAA ATCGTGCTAG TGGTTAATTG
GGCAACTTTT GAGTTCAAGT GGGTAAGAGA AATACTAGCA CCCTAGCAGT GTACATTGGC AATGGAAGGG TTTAATTTAG
TCTTGCCAAC TCAGTTAATT TTGCAAAGGA TGATTATGAC ATCGGCGAAT TTGTTATGTG ATCAATTTTA AGAGAACGGG
GCTTTTGCCT TACAAGTTCT TCTAATCCAC AGCACTTATG AAATTCAGAA AATGGACCGG TTACTCGGCT TCTTAACTAA
ACCTATGGCA ACCAGGATGC ATCATCTCAT CAAGTGTATC CATAGCATTA GGCTCCGCAT CCCTGTCTAT TTAACTTGTG
AAGTTGGAGA TTATTTGAAT GTTACATGTT TTTCGCTGAT AGTGTGATTG ACCTCTTGAA GGTTGTGATG CTTGGTTTGG
ATGCAGCTGG CAAGACAACA ATTTTGTATA GGCTGCACAT GGGAGAAGTT CTTTCAACGG TTCCTACAGT AGGTACGTGG
CTCAAGCTCA ATGACTCATC TAACGCATCG TTTTTAATGT ACTTATTTAT GTATCGTATT AAATGATCGT AGATTGCCAT
GCAGACTATT GCAGTACTTG ACACTTAGCT TCAGCTTATA TGGGCAATAA AAGTACATGT CCGTTTTTTG GGTGGTTGAA
GGGATCCATG ATATGATTTT CCTGCTAAGT ACAGGGTCGA CACTCAACAG TCAGAAATAA ACCGAAAAAC ATGACCGACG
ATATTTGGTT AATCAGTGTA CAGGGCATGC TTGGCAGGCA TAACTGTTCT TGTGGAATTG ATTTGGAAAC TTTAAGCTTA
CAACTGATTG TTTAAAAAAT TAATTACTTC AAATCATGTA TATTTCCAAG AAAGAAAGTG CAATATGATA GAAGCTGGAA
ACTGGCTTGA CGTTTCTTGA TAAGGTATTA GTTTGTAGTA CCTCCTGGTA CCTTGGCATA GAAGATACTG AGAGGTGCCA
AAGATTTACA CTAAAAAGTA TATTCTTGAG GATTGTAAAA AAACAAGGTT ATAAAAGCCT ATATATTGTT ATTTTAATGA
GAAGCCTTGC TATGATTTTG GACATCAAAC TTGATACAAT AAATATGGTC ACTCTATGTG ATTATTAGAC AACCTTATAT
GTACCTTTCC TCTACAGTTT GGGCTTTGGG CAGTAAAGAT GGAAAACTTA TGTAACAAAA ATACATTGTT GGATTTGGTT
TCCTCGTTAT GTGGGTGGTA CTTTTTTCCT TTCAAATCAC GTATCACTCA AGACAGCTTT TCCTCAATCC AATTGAGGAA
GTAGCACAGA TTTGTTTACT TTTTTTCAGT CGTTTATAAT AAATTATATA ATTCTATACC TCATAATTCA TTGATGTGCT
CGACTTTTTC CCAATCATTG ATCTCATGTC TATATCCAAT AATACCATGT ACCCTCTGCA GGTTTTAACG TAGAGAAGGT
TCAGTACAAG AATGTGGTAT TTACTGTGTG GGATGTTGGC GGACAAGAAA AGCTCAGGCC ATTATGGAAG ATGTACCTCA
GCAATTCTGA TGCACTGGTA ATAACTAGTA GATTGAATTT ATATACACAT GTTGATATTT AGCTTGGCAC CTTGTCATTC
CGCCCTGTTA TAGTGCCTTT AGTACTTTCC CAAGTCTTGG TTTGATATTG TCATGCACAT ATTGTTTGTT TTCAGTTCAG
GTTGATATCA TATATTAGCA CCTTTTGCAA ATTTTTTTCT TGTCGTTGAA TGTGTCCCTA AAGCCTTTCA GTTTTTAGGT
GAAGTTTGTA AATCGATATG AATGACGTAA GCGAGGAGCG TCTAGTCTTC TTTATAAGGA CATCTCTTTA GCTAATTCGA
TTAGGTGTTT CATGACAATT CCAATTGCTA TATGCATCAT ATGCATATCT TTTGCTGCTG AAGTTAAGGA TGTCTTTCTG
CTTTCAATTT GTTGTTTTTT CAGATACATT ATTGAAGCCA TACATTTCTG TCATATTTAT GAAATTTGTT GCTTTCAATT
TGTTGTAGAT CTACGTTGTT GATTCATTGG ACAGAGAAAG GATTATAGAC GCCAGACAAG AATTTCAGGT TAGAATTATA
TTATCTCTGT CATTGTAGTA GTTCCTGTCT CCCCAAATTA TGTTGGCTGA GAATATGGGA TCCTACTAAC TTGGTATTCC
TTTACCCTTT TCAGACCATT ATCAAGGACC CACTGATGGC AAACAGCATA ATCTTAGTAT TTGCAAACAA ACAGGACCTG
GTAAGTTAAA CCAAGAATTT GAATAACTAA TGATTAATTG CTTGCCTGTT CATGACCTCA TTTACACACC TTTTAAAATT
ACTGTGTCGC GTGTTCATTC TTTTTACCAG CTTGTCTGTT ATTATGTTCA GTATCGTCTT TGTTTATCAT GTGCAGTCTT
TTTTATTATA TATAGATCTC CTTACAAAAT TCTCCATTTC TTTTTGTATG ATGTTGGTTA GTTCAATTTA CATTATGAGA
TGGGGGTAGT ATGACTCTAT CTGCTACATA TTGGACTAAA GATCTGAGTT ACTTTCAACA ATACACGGTG TTGATCGTGC
TGTCAGGGAT TTTGTACTCT GATGAGGCTT TAGCTTAGAA ATATCAATTC TTTATGTTCC ATATTGCTAA CTGGAAATCA
ATGTGTAGAT CTGTTCCACT GTTGAAGCCA TACATTTCCA TCAGATTTAT GAAATTGTCA AATATAAGAG TGGTACTTAT
AGACTAAAAT ATTATCTTCA CACAGAGAGG TGCGATGAGC CCAGATGAGG TGAGCGAGGG GCTAGGCCTG CACGACCTCA
GGAACAGGAT ATGGCATATA CAAGGGACAT GCGCTCTCCG TGGTGAGGGA CTCTACGATG GACTTGATTG GCTCGCATCC
ACCCTGAAGC AATTGCAAGA GACAGGCCAT GCAACTTCAG TCGCCGGCCC TTCCATCTGA TTTCGCTAGA GAAGGTATTG
TCTCACTTTG AGTGCTGACC TTTTTTTTTT CCTCATGTTC TCTTTCTTGC ACCTGACATA GTTACCACTT ACACTACCTG
TTCTGTTCCC CCCAGAGATG CCAATGCCTC AACTAGTCAA CCAATCTGAT GCTCCTGGGC AGTCATCCTT CTGTTCATCC
AATGAGAATA TTGAGTTCCT TGGTGCATGC GTGATCTTCG CTATCGGCTT TCTTGGTGTG GCTGCTCGCA GAGGAGGGCA
TTCAATCGCT GTGTTCATAT GAGCAAACTC ATTTGACAGT AACTTGCGGC ATAATTTTCT CCTAAAATGT TTGTAAAGTG
TTTGGACGTC TGTGTACTTT GTTGTAGTGA ACAAGAGCTG AGTAGTTTGC ACGGACCGTG CTTGTGTATA CTTGATGGCA
CGTCCACATG ATTGTTTGCT GATTGCCTAT CAATAAGACG GTTGGATG

Locus: Os02g0128600

Loading...

Locus: Os02g0128600

Loading...