Os02t0134200-01

Locus

Os02g0134200

Description

DUF1645 family protein, Regulation of stress-tolerance and grain length

RAP-DB Gene Symbol Synonym(s)

OsSGL

RAP-DB Gene Name Synonym(s)

STRESS_tolerance and GRAIN_LENGTH

CGSNL Gene Symbol

SGL

CGSNL Gene Name

STRESS_TOLERANCE AND GRAIN_LENGTH

Oryzabase Gene Symbol Synonym(s)

OsSGL

Oryzabase Gene Name Synonym(s)

STRESS_tolerance and GRAIN_LENGTH

Transcript Evidence

AK108331

Protein Evidence

Q6Z6I0

Literature

PMID: 27917884

Note

Manual Curation

December 12, 2016

Functional domain (InterPro)

Protein of unknown function DUF1645, plant (IPR012442)

Full-length cDNA

002-142-A01 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0134200-01)

RiceXPro (AK108331)

Others

Oryzabase (21580)

KEGG (Os02t0134200-01)

Transcript

1062 bp

>Os02t0134200-01 DUF1645 family protein, Regulation of stress-tolerance and grain length
CTCACACACCACACCACACCAACATCGAGCGCGTCGAGTCGAATCCAATCCACTCCACTC
CACCCCGCGATCTCCTCTCCTCTCGTCTCCGGCGAAGACGACGTGAtgccacccagcgcc
gccgccgcagccgcgatggcgcagtcgccgcgcagcctccacacgctgatcagcttcggc
cgcggcgccgacggcgtcgacgacgatgaggccacgcccgcgtcggtcgacgttggtgac
gcggagggcgccgggctcgacctcgacttCGCGTTCGCGCCGCCGGTGTCGGCGGCCGAG
CTGGCGCCGGCCGACGACATCTTCGCGCACGGCCGCATCGTGCCGGCGTACCCggtgttc
gaccgcagcctcctcgacctctcgcccggcgacgcctccacggcggcgccctccgccgac
acCTACTGCGCGTGGACGCCGCGCTCGGCGCCGGGCTCGCCCGGCCGCGACAGGTTCCCC
AAGAGCGCGTCCACCGGCGGAGAGTCGTCGTCGTCATCGCGGCGCTGGCGCCTGCGCGAC
CTCGTCGGCGCCGGCGGCCGCTCCCGCAGCGACGGCAAGGACAAGTTCGCCTTCCTGCAC
CACCACGCCGCCGCGCCGCCATCATCCAAACTGAAGACTCCTCCTCCCCCTCAACAACCA
CAGCAGAAGAAGCAGAGCGCCGTGAAGACGAAGCCGGCGGCGAAGAAGGGCGTGGTCACC
GAGATGGACATGGCCACCGCGCACAGGCTCTTCTACAGCAAGGCCAGCGCCGGCGGCGAC
CGGCGGCCGCAGCAAGCCTCGTACCTGACGTACCGACCGGCGTTCAGCGGCCTCTTCGCG
CTCGGCCGGTCGCAACACCACACCGCCTATTAGTTTAATCACTTGGTCAATAACCAAACC
AACTGATTACTAGTGGTAGTTGTTGTTAAATTAATTGTTTTGTTGTAAAAGTGTTCAAAA
TTTTCGGCGAAATTCGAGTCGAGATTTCTCGTTTGTACTAGAACCTTATCATGTACATAA
ATGGAAAAAGAGAGGAATGAAATTTGAGAGATGATTTTGTCT

CDS

768 bp

>Os02t0134200-01 DUF1645 family protein, Regulation of stress-tolerance and grain length
Atgccacccagcgccgccgccgcagccgcgatggcgcagtcgccgcgcagcctccacacg
ctgatcagcttcggccgcggcgccgacggcgtcgacgacgatgaggccacgcccgcgtcg
gtcgacgttggtgacgcggagggcgccgggctcgacctcgacttCGCGTTCGCGCCGCCG
GTGTCGGCGGCCGAGCTGGCGCCGGCCGACGACATCTTCGCGCACGGCCGCATCGTGCCG
GCGTACCCggtgttcgaccgcagcctcctcgacctctcgcccggcgacgcctccacggcg
gcgccctccgccgacacCTACTGCGCGTGGACGCCGCGCTCGGCGCCGGGCTCGCCCGGC
CGCGACAGGTTCCCCAAGAGCGCGTCCACCGGCGGAGAGTCGTCGTCGTCATCGCGGCGC
TGGCGCCTGCGCGACCTCGTCGGCGCCGGCGGCCGCTCCCGCAGCGACGGCAAGGACAAG
TTCGCCTTCCTGCACCACCACGCCGCCGCGCCGCCATCATCCAAACTGAAGACTCCTCCT
CCCCCTCAACAACCACAGCAGAAGAAGCAGAGCGCCGTGAAGACGAAGCCGGCGGCGAAG
AAGGGCGTGGTCACCGAGATGGACATGGCCACCGCGCACAGGCTCTTCTACAGCAAGGCC
AGCGCCGGCGGCGACCGGCGGCCGCAGCAAGCCTCGTACCTGACGTACCGACCGGCGTTC
AGCGGCCTCTTCGCGCTCGGCCGGTCGCAACACCACACCGCCTATTAG

Protein

255 aa

>Os02t0134200-01 DUF1645 family protein, Regulation of stress-tolerance and grain length
MPPSAAAAAAMAQSPRSLHTLISFGRGADGVDDDEATPASVDVGDAEGAGLDLDFAFAPP
VSAAELAPADDIFAHGRIVPAYPVFDRSLLDLSPGDASTAAPSADTYCAWTPRSAPGSPG
RDRFPKSASTGGESSSSSRRWRLRDLVGAGGRSRSDGKDKFAFLHHHAAAPPSSKLKTPP
PPQQPQQKKQSAVKTKPAAKKGVVTEMDMATAHRLFYSKASAGGDRRPQQASYLTYRPAF
SGLFALGRSQHHTAY*

5'UTR

chr02:1800707..1800811 (- strand) : 105 bp

CDS

chr02:1799939..1800706 (- strand) : 768 bp

3'UTR

chr02:1799750..1799938 (- strand) : 189 bp

FASTA

>Os02t0134200-01 class=Sequence position=chr02:1799750..1800811 (- strand)
CTCACACACC ACACCACACC AACATCGAGC GCGTCGAGTC GAATCCAATC CACTCCACTC CACCCCGCGA TCTCCTCTCC
TCTCGTCTCC GGCGAAGACG ACGTGAtgcc acccagcgcc gccgccgcag ccgcgatggc gcagtcgccg cgcagcctcc
acacgctgat cagcttcggc cgcggcgccg acggcgtcga cgacgatgag gccacgcccg cgtcggtcga cgttggtgac
gcggagggcg ccgggctcga cctcgacttC GCGTTCGCGC CGCCGGTGTC GGCGGCCGAG CTGGCGCCGG CCGACGACAT
CTTCGCGCAC GGCCGCATCG TGCCGGCGTA CCCggtgttc gaccgcagcc tcctcgacct ctcgcccggc gacgcctcca
cggcggcgcc ctccgccgac acCTACTGCG CGTGGACGCC GCGCTCGGCG CCGGGCTCGC CCGGCCGCGA CAGGTTCCCC
AAGAGCGCGT CCACCGGCGG AGAGTCGTCG TCGTCATCGC GGCGCTGGCG CCTGCGCGAC CTCGTCGGCG CCGGCGGCCG
CTCCCGCAGC GACGGCAAGG ACAAGTTCGC CTTCCTGCAC CACCACGCCG CCGCGCCGCC ATCATCCAAA CTGAAGACTC
CTCCTCCCCC TCAACAACCA CAGCAGAAGA AGCAGAGCGC CGTGAAGACG AAGCCGGCGG CGAAGAAGGG CGTGGTCACC
GAGATGGACA TGGCCACCGC GCACAGGCTC TTCTACAGCA AGGCCAGCGC CGGCGGCGAC CGGCGGCCGC AGCAAGCCTC
GTACCTGACG TACCGACCGG CGTTCAGCGG CCTCTTCGCG CTCGGCCGGT CGCAACACCA CACCGCCTAT TAGTTTAATC
ACTTGGTCAA TAACCAAACC AACTGATTAC TAGTGGTAGT TGTTGTTAAA TTAATTGTTT TGTTGTAAAA GTGTTCAAAA
TTTTCGGCGA AATTCGAGTC GAGATTTCTC GTTTGTACTA GAACCTTATC ATGTACATAA ATGGAAAAAG AGAGGAATGA
AATTTGAGAG ATGATTTTGT CT

Locus: Os02g0134200

Loading...

Locus: Os02g0134200

Loading...