Os02t0139700-01

Locus

Os02g0139700

Description

Similar to Cycloartenol synthase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsOSC2, CAS1

Oryzabase Gene Name Synonym(s)

oxidosqualene cyclase 2, cycloartenol synthase 1

Transcript Evidence

AK121211 (DDBJ, Best hit)

Protein Evidence

Q941S0 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: intramolecular transferase activity (GO:0016866)

Functional domain (InterPro)

Prenyltransferase/squalene oxidase (IPR001330)

Terpene synthase, conserved site (IPR002365)

Terpenoid cylases/protein prenyltransferase alpha-alpha toroid (IPR008930)

Squalene cyclase (IPR018333)

Full-length cDNA

J023089G09 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0139700-01)

RiceXPro (AK121211)

Others

Oryzabase (10201)

KEGG (Os02t0139700-01 (EC:5.4.99.8))

Transcript

2649 bp

>Os02t0139700-01 Similar to Cycloartenol synthase.
AACGCGGCGGTATCTCGTGCTCGTGCGCCGCCCCGCGCTCCCGATCGATTCGCTCTCTCG
CCGCCGCCGCCGCAGCTGACGCCGTCGATTTGGTTGGTTGGTTGATCGGCGGCGAGGAGG
GGGAGGGGGGGGGGGAGGATGTGGCGGCTGAGGGTGGCGGAGGGCGGGGGGGACCCGTGG
CTGCGCACGAAGAACGGCCACGTGGGGCGCCAGGTCTGGGAGTTCGACCCCGCCGCGGGC
GACCCCGACGAGCTCGCCGCCGTCGAGGCCGCCCGCCGCGGTTTCGCCGCCCGCCGCCAC
GAGCTCAAGCACAGCTCCGACCTCCTCATGCGCATGCAGTTTGCTAAAGCAAATCCTCTT
AAGCTGGACATTCCAGCTATCAAGCTAGAGGAGCATGAAGCTGTTACAGGCGAAGCTGTA
TTATCCTCTCTAAAAAGGGCAATTGCTCGTTATTCTACTTTTCAAGCACATGATGGACAC
TGGCCTGGGGATTATGGTGGTCCCATGTTCCTTATGCCAGGCTTGATTATAACATTATAT
GTGAGCGGAGCGCTGAACACTGCTTTGTCATCTGAACATCAGAAGGAGATACGGCGGTAT
CTCTACAATCATCAGAATGAAGATGGAGGATGGGGTTTGCACATTGAGGGCCACAGCACC
ATGTTTGGCTCAGCGTTGACATATGTTTCTTTGAGATTGCTTGGGGAGGGGCCAGATAGC
GGCGATGGAGCTATGGAGAAAGGACGAAAATGGATTTTAGACCATGGGGGAGCAACTTAT
ATTACATCATGGGGCAAGTTTTGGCTTTCGGTGCTTGGTGTATTTGACTGGTCTGGCAAC
AACCCAGTGCCACCAGAAATATGGTTGTTGCCATATTTCCTGCCGATTCATCCAGGGCGA
ATGTGGTGTCATTGCCGGATGGTTTATTTGCCTATGTGTTACATTTATGGAAAGAGGTTT
GTGGGCCCAGTTACACCAATTATATTGGAATTAAGAAAGGAACTCTACGAAGTACCCTAC
AATGAAGTTGATTGGGACAAGGCTCGCAATCTATGTGCTAAGGAAGATCTGTACTATCCA
CATCCATTCGTGCAGGATGTATTATGGGCCACTCTCCACAAATTTGTTGAACCAGCTATG
TTGCGTTGGCCTGGGAACAAATTGAGGGAGAAAGCTTTGGACACTGTCATGCAGCATATT
CATTATGAAGATGAGAACACCCGATATATTTGCATTGGTCCAGTAAACAAGGTATTAAAT
ATGCTTGCTTGCTGGATTGAAGATCCAAACTCAGAGGCATTCAAACTCCACATTCCAAGA
GTCCACGATTACCTATGGATTGCAGAAGATGGCATGAAAATGCAGGGTTATAATGGAAGC
CAGCTGTGGGACACAGCTTTCACAGTTCAAGCTATAGTGGCTACTGGCCTCATTGAAGAA
TTTGGTCCTACTCTTAAACTAGCACATGGCTACATAAAGAAAACGCAGGTTATCGATGAC
TGCCCTGGAGATCTTAGTCAGTGGTACCGCCACATATCTAAAGGTGCATGGCCCTTTTCT
ACTGCTGATCATGGTTGGCCTATATCAGATTGCACTGCAGAAGGACTTAAGGCGGCATTA
TTGCTATCGAAGATTTCTCCAGATATTGTTGGCGAAGCAGTGGAAGTTAATAGACTGTAT
GATTCTGTCAATTGTTTGATGTCATACATGAATGATAATGGTGGATTTGCAACATATGAA
CTCACAAGGTCTTATGCCTGGCTGGAGCTTATCAATCCTGCTGAGACCTTTGGGGACATT
GTGATTGATTATCCTTATGTGGAATGCACTTCAGCAGCAATTCAGGCCCTGACAGCATTT
AAAAAGCTCTACCCTGGACACCGCAAGAGTGAAATAGACAACTGTATAAGCAAAGCTGCT
AGCTTTATTGAGGGTATTCAAAAAAGCGATGGTTCATGGTATGGTTCTTGGGCTGTTTGT
TTTACCTATGGCACATGGTTTGGTGTAAAGGGATTAGTTGCTGCTGGTAGGACATTCAAA
AACAGTCCTGCAATCAGAAAGGCATGTGACTTTTTGTTGTCAAAAGAGCTTCCTTCTGGA
GGCTGGGGAGAAAGCTATTTGTCATCCCAAGATCAGGTTTATACCAATCTCGAAGGGAAG
CGACCTCATGCGGTGAACACTGGTTGGGCCATGCTAGCCCTAATCGATGCAGGGCAGGCT
GAGAGAGATCCAATTCCTTTGCATCGAGCAGCGAAGGTTTTGATCAACTTACAATCGGAA
GATGGTGAATTTCCCCAGCAAGAGATCATTGGAGTCTTCAACAAAAACTGCATGATCAGC
TACTCCGAGTATAGAAACATCTTCCCTATTTGGGCCCTTGGGGAGTACCGTCGCCGCGTC
TTGGCCGCAGACAAGTAGTTCAGCACGAGCAGAGCAGCAGCACCAACAATGTGCATGTAT
TTATACGTGAAATAATGTAGCTATGTTTCAGTTGTAATAATGTGGCTATATGTATTCTCC
CGTTAGTGATGCCACGCGAGCGTAGTCAAATAGAAACGCATTTTGACACAAGTTCGAGAT
GAATGGATTCCTGAATCGAATGTTTGTGTTCAGATAGAATTCTTGCCACGCAAAATACAA
ACATGAAAG

CDS

2280 bp

>Os02t0139700-01 Similar to Cycloartenol synthase.
ATGTGGCGGCTGAGGGTGGCGGAGGGCGGGGGGGACCCGTGGCTGCGCACGAAGAACGGC
CACGTGGGGCGCCAGGTCTGGGAGTTCGACCCCGCCGCGGGCGACCCCGACGAGCTCGCC
GCCGTCGAGGCCGCCCGCCGCGGTTTCGCCGCCCGCCGCCACGAGCTCAAGCACAGCTCC
GACCTCCTCATGCGCATGCAGTTTGCTAAAGCAAATCCTCTTAAGCTGGACATTCCAGCT
ATCAAGCTAGAGGAGCATGAAGCTGTTACAGGCGAAGCTGTATTATCCTCTCTAAAAAGG
GCAATTGCTCGTTATTCTACTTTTCAAGCACATGATGGACACTGGCCTGGGGATTATGGT
GGTCCCATGTTCCTTATGCCAGGCTTGATTATAACATTATATGTGAGCGGAGCGCTGAAC
ACTGCTTTGTCATCTGAACATCAGAAGGAGATACGGCGGTATCTCTACAATCATCAGAAT
GAAGATGGAGGATGGGGTTTGCACATTGAGGGCCACAGCACCATGTTTGGCTCAGCGTTG
ACATATGTTTCTTTGAGATTGCTTGGGGAGGGGCCAGATAGCGGCGATGGAGCTATGGAG
AAAGGACGAAAATGGATTTTAGACCATGGGGGAGCAACTTATATTACATCATGGGGCAAG
TTTTGGCTTTCGGTGCTTGGTGTATTTGACTGGTCTGGCAACAACCCAGTGCCACCAGAA
ATATGGTTGTTGCCATATTTCCTGCCGATTCATCCAGGGCGAATGTGGTGTCATTGCCGG
ATGGTTTATTTGCCTATGTGTTACATTTATGGAAAGAGGTTTGTGGGCCCAGTTACACCA
ATTATATTGGAATTAAGAAAGGAACTCTACGAAGTACCCTACAATGAAGTTGATTGGGAC
AAGGCTCGCAATCTATGTGCTAAGGAAGATCTGTACTATCCACATCCATTCGTGCAGGAT
GTATTATGGGCCACTCTCCACAAATTTGTTGAACCAGCTATGTTGCGTTGGCCTGGGAAC
AAATTGAGGGAGAAAGCTTTGGACACTGTCATGCAGCATATTCATTATGAAGATGAGAAC
ACCCGATATATTTGCATTGGTCCAGTAAACAAGGTATTAAATATGCTTGCTTGCTGGATT
GAAGATCCAAACTCAGAGGCATTCAAACTCCACATTCCAAGAGTCCACGATTACCTATGG
ATTGCAGAAGATGGCATGAAAATGCAGGGTTATAATGGAAGCCAGCTGTGGGACACAGCT
TTCACAGTTCAAGCTATAGTGGCTACTGGCCTCATTGAAGAATTTGGTCCTACTCTTAAA
CTAGCACATGGCTACATAAAGAAAACGCAGGTTATCGATGACTGCCCTGGAGATCTTAGT
CAGTGGTACCGCCACATATCTAAAGGTGCATGGCCCTTTTCTACTGCTGATCATGGTTGG
CCTATATCAGATTGCACTGCAGAAGGACTTAAGGCGGCATTATTGCTATCGAAGATTTCT
CCAGATATTGTTGGCGAAGCAGTGGAAGTTAATAGACTGTATGATTCTGTCAATTGTTTG
ATGTCATACATGAATGATAATGGTGGATTTGCAACATATGAACTCACAAGGTCTTATGCC
TGGCTGGAGCTTATCAATCCTGCTGAGACCTTTGGGGACATTGTGATTGATTATCCTTAT
GTGGAATGCACTTCAGCAGCAATTCAGGCCCTGACAGCATTTAAAAAGCTCTACCCTGGA
CACCGCAAGAGTGAAATAGACAACTGTATAAGCAAAGCTGCTAGCTTTATTGAGGGTATT
CAAAAAAGCGATGGTTCATGGTATGGTTCTTGGGCTGTTTGTTTTACCTATGGCACATGG
TTTGGTGTAAAGGGATTAGTTGCTGCTGGTAGGACATTCAAAAACAGTCCTGCAATCAGA
AAGGCATGTGACTTTTTGTTGTCAAAAGAGCTTCCTTCTGGAGGCTGGGGAGAAAGCTAT
TTGTCATCCCAAGATCAGGTTTATACCAATCTCGAAGGGAAGCGACCTCATGCGGTGAAC
ACTGGTTGGGCCATGCTAGCCCTAATCGATGCAGGGCAGGCTGAGAGAGATCCAATTCCT
TTGCATCGAGCAGCGAAGGTTTTGATCAACTTACAATCGGAAGATGGTGAATTTCCCCAG
CAAGAGATCATTGGAGTCTTCAACAAAAACTGCATGATCAGCTACTCCGAGTATAGAAAC
ATCTTCCCTATTTGGGCCCTTGGGGAGTACCGTCGCCGCGTCTTGGCCGCAGACAAGTAG

Protein

760 aa

>Os02t0139700-01 Similar to Cycloartenol synthase.
MWRLRVAEGGGDPWLRTKNGHVGRQVWEFDPAAGDPDELAAVEAARRGFAARRHELKHSS
DLLMRMQFAKANPLKLDIPAIKLEEHEAVTGEAVLSSLKRAIARYSTFQAHDGHWPGDYG
GPMFLMPGLIITLYVSGALNTALSSEHQKEIRRYLYNHQNEDGGWGLHIEGHSTMFGSAL
TYVSLRLLGEGPDSGDGAMEKGRKWILDHGGATYITSWGKFWLSVLGVFDWSGNNPVPPE
IWLLPYFLPIHPGRMWCHCRMVYLPMCYIYGKRFVGPVTPIILELRKELYEVPYNEVDWD
KARNLCAKEDLYYPHPFVQDVLWATLHKFVEPAMLRWPGNKLREKALDTVMQHIHYEDEN
TRYICIGPVNKVLNMLACWIEDPNSEAFKLHIPRVHDYLWIAEDGMKMQGYNGSQLWDTA
FTVQAIVATGLIEEFGPTLKLAHGYIKKTQVIDDCPGDLSQWYRHISKGAWPFSTADHGW
PISDCTAEGLKAALLLSKISPDIVGEAVEVNRLYDSVNCLMSYMNDNGGFATYELTRSYA
WLELINPAETFGDIVIDYPYVECTSAAIQALTAFKKLYPGHRKSEIDNCISKAASFIEGI
QKSDGSWYGSWAVCFTYGTWFGVKGLVAAGRTFKNSPAIRKACDFLLSKELPSGGWGESY
LSSQDQVYTNLEGKRPHAVNTGWAMLALIDAGQAERDPIPLHRAAKVLINLQSEDGEFPQ
QEIIGVFNKNCMISYSEYRNIFPIWALGEYRRRVLAADK*

5'UTR

chr02:2136958..2137095 (- strand) : 138 bp

CDS

chr02:2136757..2136957 (- strand) : 201 bp

chr02:2135418..2135603 (- strand) : 186 bp

chr02:2135162..2135251 (- strand) : 90 bp

chr02:2134891..2135085 (- strand) : 195 bp

chr02:2134707..2134791 (- strand) : 85 bp

chr02:2134408..2134574 (- strand) : 167 bp

chr02:2133612..2133800 (- strand) : 189 bp

chr02:2132859..2132972 (- strand) : 114 bp

chr02:2132514..2132636 (- strand) : 123 bp

chr02:2132301..2132423 (- strand) : 123 bp

chr02:2131989..2132087 (- strand) : 99 bp

chr02:2131149..2131205 (- strand) : 57 bp

chr02:2130780..2130826 (- strand) : 47 bp

chr02:2130530..2130673 (- strand) : 144 bp

chr02:2130230..2130407 (- strand) : 178 bp

chr02:2129463..2129543 (- strand) : 81 bp

chr02:2129281..2129364 (- strand) : 84 bp

chr02:2128660..2128776 (- strand) : 117 bp

3'UTR

chr02:2128429..2128659 (- strand) : 231 bp

FASTA

>Os02t0139700-01 class=Sequence position=chr02:2128429..2137095 (- strand)
AACGCGGCGG TATCTCGTGC TCGTGCGCCG CCCCGCGCTC CCGATCGATT CGCTCTCTCG CCGCCGCCGC CGCAGCTGAC
GCCGTCGATT TGGTTGGTTG GTTGATCGGC GGCGAGGAGG GGGAGGGGGG GGGGGAGGAT GTGGCGGCTG AGGGTGGCGG
AGGGCGGGGG GGACCCGTGG CTGCGCACGA AGAACGGCCA CGTGGGGCGC CAGGTCTGGG AGTTCGACCC CGCCGCGGGC
GACCCCGACG AGCTCGCCGC CGTCGAGGCC GCCCGCCGCG GTTTCGCCGC CCGCCGCCAC GAGCTCAAGC ACAGCTCCGA
CCTCCTCATG CGCATGCAGG TAAAATGCCT CTCCCCGCGC CGCCACCCTC TCGCTCCTAC TACTGTACTA TATACTACCC
CCTTTGCTTA GCTCGTCTGA ATTGCTCGTG GCCGGAGGCG GCGAGGCGCA CATCTGCGCG CGGTGTTCTC TCGCGGGAGG
CGGCGTCACC GATCGAGCGC GACGCTGTCG CTGGAAGCGT TCAATGCGGT GATGATGTGA TTGCTGTTTC AGATACAGTG
TATTTCGGTT TAATGCGCAT CGGGTGGATG GGTGGGTGAG CGGAGATGGG CTCTCGCAAC TTGCACGCGC CTTCTTTTTT
CCTTATTCGT GCTAGAATTC GTGGTGGATG CGATGCAAGC CGGCGATCGA TCTCTTCCCT TTTCGCTATG CCTCATCCGT
TTGCATGTTC CAGTGGTGGA TTTTGATGTG GATGCTGCAT TCAATTCCAG CCATACGCCC CATACGATTC GAGGTTGCGG
CGCAGAGTTG CCCATTGACA ATATAGAGAT GTTTCGCTAT CCATGTTAAT TAGCAGTAGT AGGATGCCCT GCACTAGTGA
ATTCTTGTTT TTTTATTATC ATTGTCTTGT CTGTGTTTCA GTGTTCCCTG AGAGCTCTGC ATCCAAATTG TTTGGTGATT
CCGGGTTGCT TGTGCACCGA GTAGCTTGGA ATTAAATTTG GGGATCTGGT GAAGTACCAT GTGGGGGGCC TCCATCCAGT
TCATTACCTA AAAATTTGGG TTCTTGTGGG GACGGCAATG GGAAGAGCTG GCTGGATAGG GATATGCCTT AACTCAAAGT
AGCTTTTAAT GTGCAGTGGC CGGTGGGCAA ATCAAACTGG GTTAGCATGT TTTTAGCCTC TTATGAGGAC TGTAGGATGC
AGAGAACTCA GGTACTTTTT ACTTCAAAAT GTCTAATACC AATTACATGT GCAAACAGTA AAAAAGTGAG ACAAATGTGA
TTATACTTGG AGGTAACTTT CTGACGTCAC GATTTTATAG ACTGTCCGGT AATATCTTAA ACGTGCAATT TTGTGCTGAA
TATTTTTCAT TTATTTACTT CTGTTTGGCT TGCCCTGAAT TCTATGTATT AGCCATGAAA TTAGTGTCTT TTTCACTAGT
CAATGCACAT GTCATCCCTG ATATTTAAGC ATTTATTTTG TATATTCTGC AGTTTGCTAA AGCAAATCCT CTTAAGCTGG
ACATTCCAGC TATCAAGCTA GAGGAGCATG AAGCTGTTAC AGGCGAAGCT GTATTATCCT CTCTAAAAAG GGCAATTGCT
CGTTATTCTA CTTTTCAAGC ACATGATGGA CACTGGCCTG GGGATTATGG TGGTCCCATG TTCCTTATGC CAGGCTTGGT
ACTCTTCTAA CTCACCACAA GTCGTTTCCA ATTTGGTTAC TCACTAAAAT TTGAACTATG GAATTTCTTT TTAATTACTC
ATAATCTTGA CCTGTATGAA AAGAAATGTT CCATACTGCC TGTTATATGT GAAAGTTACT CATTATATTT TCTATTTTAC
TCAGATTATA ACATTATATG TGAGCGGAGC GCTGAACACT GCTTTGTCAT CTGAACATCA GAAGGAGATA CGGCGGTATC
TCTACAATCA TCAGGTAAGA AATCTAATTA CACTTCTACA ATCTTGAAAT AAGTAAAGGC AATGTTTTCC TTTTCTGTGT
GTAAGTGTAG AATGAAGATG GAGGATGGGG TTTGCACATT GAGGGCCACA GCACCATGTT TGGCTCAGCG TTGACATATG
TTTCTTTGAG ATTGCTTGGG GAGGGGCCAG ATAGCGGCGA TGGAGCTATG GAGAAAGGAC GAAAATGGAT TTTAGACCAT
GGGGGAGCAA CTTATATTAC ATCATGGGGC AAGTTTTGGC TTTCGGTAGG GAGTTAACAC TTCCTCTCTC TGTATCTTGA
CCGCTGTAAT AATCTAACCT GGTTTTTAAA TGTAACAACT CTTTATATTC CCTAATCATG TCAGGTGCTT GGTGTATTTG
ACTGGTCTGG CAACAACCCA GTGCCACCAG AAATATGGTT GTTGCCATAT TTCCTGCCGA TTCATCCAGG TTGTGCTCCC
CCTGTAGGCA TTTATATCTT CTCCTATTGA ATGTATATGA TAATATATTC ATTACTTTGC TTGCTGTAGA TTACATTAGT
GCTAGTAATT TCTTACTGAT AAACTTTATA ATTATGTGAA GGGCGAATGT GGTGTCATTG CCGGATGGTT TATTTGCCTA
TGTGTTACAT TTATGGAAAG AGGTTTGTGG GCCCAGTTAC ACCAATTATA TTGGAATTAA GAAAGGAACT CTACGAAGTA
CCCTACAATG AAGTTGATTG GGACAAGGCT CGCAATCTAT GTGCTAAGGT TTGTTAATTA CTTAATGTTT GTTGTATTCT
CGTGCATAAG ATAATTTGAC AACAGTATGG TAAAATATTA TCTTATGAGG TGAGTTAAAA AATCATCAGT AATATATTGT
CATCTTACTT TGAACACATT TTGGACGCAA AAACTGTGCC TTTTTTGAAT AATGtattcc atatgtttct aaataattgg
cattgttgac ttcagagcac aaattttgac caccatatta tttatcattt ttaaatactt aaaagtatat tatattattg
aagtgataaa tataacctta gaactttcaa ttaccatgac tgtacaattt aaaatttaga agtagccaaa gtttaaattt
tcttCTTGTT CCCTGGTCGA TTACAAGCCA ATAGTTGAAA TCATGACTTT GACTCGTAAT CTGATGATTT AAGCTCCTTA
CAAGCTGAAG GACTTTGTTA TGCTTAGTTG TTATCGTGCA TGGCTTGAAA AGTTATTGTA GTAAGCCCAA AATTTTACAT
AATTTATCCT ATGTATCTTG CTTTTATCAC TTTGTGTTTA ATAAGATCTG GATTTTTCTT TCTGAAAGTT TTTTTTTTTG
GGTATTGTAT TGCAGGAAGA TCTGTACTAT CCACATCCAT TCGTGCAGGA TGTATTATGG GCCACTCTCC ACAAATTTGT
TGAACCAGCT ATGTTGCGTT GGCCTGGGAA CAAATTGAGG GAGAAAGCTT TGGACACTGT CATGCAGCAT ATTCATTATG
AAGATGAGAA CACCCGATAT ATTTGCATTG GTCCAGTAAA CAAGGTAATT TGAAGACTAT GATTGCTTAT TGGTTCATTA
CAAAAGAAAG TGGGTCGTTC TTTCTTTTCT TGCTGCAGGC ATAAAAGGGA AACCATTCCA TTATATGGGT ACACACTTAC
AATTTTCAAC TTTGAATGGA ATACATGTGC AGCTGCAATT AGAGGGAAAC TGTCATAATT ACTGTGTTTT ACAGTATTCC
CCTTTAAATT TTCACCCATT TTTTTTTTAT CTTGGTTTAC TATTTTATTG TAGCGACGAT GGCTCCTCGC ACCACCCTTT
TTTTGGGTGG CCACCAAGCG GCCTATATAG ATTAAAAATG TTTTAGTTGC ACTACCTTCT CTCAAGCGGC AAGTTCACTG
TCATTCTTCT TCCCCTTCTA TGTTTCTTTT GTTTTAAAAC ATGAACATTT CTGCCAAAAT AAGCCTATTA TAGTCCTGTG
AAGACATATA TAGGTAGCAA AGAAGCAATT TATTTTTGAA TGGTTCATTA AACTTCAGAT TATGGAGTTT CTTTTTGTTT
CTTCCTCCCG TAGCTATAAG ATGTAACTAC TCTTGATGCT TTAATACCTG ATGAATTAAA CTGCTCAGTC ATGTCAGGCA
ATACATTGTG TTCTTGTCAT TCAAATCTAT TCTCTCTATT CAGGTATTAA ATATGCTTGC TTGCTGGATT GAAGATCCAA
ACTCAGAGGC ATTCAAACTC CACATTCCAA GAGTCCACGA TTACCTATGG ATTGCAGAAG ATGGCATGAA AATGCAGGTC
ACCTTTTTTC TTTACTCTAA CTTCCAACAA GAAAGTTGGT AACTTTGGCA CAAGACACCT ATTGAACAAG TGTGATTTAC
TGTCTATTGA TGCCATTGGA AAATTGTTTT GGCATAATTT CTGCCAATGA AGTTTTTAAC ATAGCATAAT TTTAGAGAAG
CATTGCATCA AGTGTGTTCT GTTTACTTTA ACTATAGATT CTTTTTGTGA CCGCTGTAGG GTTATAATGG AAGCCAGCTG
TGGGACACAG CTTTCACAGT TCAAGCTATA GTGGCTACTG GCCTCATTGA AGAATTTGGT CCTACTCTTA AACTAGCACA
TGGCTACATA AAGAAAACGC AGGTGCATGC CTCATGCATG TTCCCTTATA CGATTATACT AATCAACATT TCAAGCCATC
TCATTACTTA CCTGTGGCTT TTATCCTGAA AGGTTATCGA TGACTGCCCT GGAGATCTTA GTCAGTGGTA CCGCCACATA
TCTAAAGGTG CATGGCCCTT TTCTACTGCT GATCATGGTT GGCCTATATC AGATTGCACT GCAGAAGGAC TTAAGGTAAA
TTTTATCTTT CAAGCTTGAG AAAATATTGT TCTTCTACTC TTCTAGCATA TATAAACTCT CTGGTATGCA TGAGAAATAG
TTATTAAGAA CCATTGTAGA TTCTCTTATG ATCTTATCTG TAAAGTTTAG TCTGTTCCAT AGCAATTGTC TGCTGGTATT
CTTGACATTG TAATAGTTTG AACTGTTCTC GTTTTGTTTT ATTATTAGGC GGCATTATTG CTATCGAAGA TTTCTCCAGA
TATTGTTGGC GAAGCAGTGG AAGTTAATAG ACTGTATGAT TCTGTCAATT GTTTGATGTC ATACATGGTA AGTTTTAATC
AGTCTTCATA TTTAAGGGTG ATTGTAAACC TCTCATGTCA TTTTAACATT TCATATGTAA CATGAATAAT ATATAAAAAA
AATGAAGCTT TGGAGCAGCA GTTCAGTAAG CATCATATAG TGTATGCCTA TATTCAAGTG CTCCTTTTGC ATTCAGAACA
AGGACAGAGA AGATGTTTGT CTTGTCCCTT TTTTAAGCAC CTCGTATTTC TGTAGGATAC CGAAACGATT TTTTTTGCTT
CTCAACCCTG ATTAATATGC ATTAGAAACT TAGAATATTG GAGATCTGCT TTTCAGTTGA TAATTAAAAT TTGGGATGTG
GTAAATGGAC TCCTGTTTAA CAATTGAATC TGCAAGTACC CTTATGTATG AAAAGGCATC CGTCACATTA TAATTTTGTG
CTTATCAATT ATCATAAGAC GTCTAATTTG TCATGGCTAT AAAGTGTCTC TAATATAGCA GTTTAATGGC TGAAGGAAGA
GTTACTAATG CATGCAGCCT TACTTTGTTG TACCGGGCAT TCAGGTTTGA TGGGTTCTCC ACTCAACTAT TCTCTAAAGA
TACATAGAAC TATGGCAAAC TAGATTTGTT GAAGTACGAC ATATAATCAT TTCTTCAAAA AAAAAATGTT TTGAAGTTCC
AGTGCTCCAC AAAGTTTTGT TGCCAATAGC TCCCCCATTC TCTTGTGTAT TTTAATTGGT GTTTTAAATA TATCACATGC
ATGTTCCTTT GGGAGGAACC TTACCTTACA GATCCTTGTA CTCTTGACAG AATGATAATG GTGGATTTGC AACATATGAA
CTCACAAGGT CTTATGCCTG GCTGGAGGTG AGTATAATTA TCTTATTTGA GGACTATCCT TCTCTTATTT GTTGTCTAGG
CAAGCAGTGC TGCAAGTCAA TTTCTGCGCT GACATCAAAA CTGGGAAGTT GCTGACTCAA AAGATGGCAC CTAAAAATTT
GTTAATTGTT CTTGTAATCT TGTTCAATAT AATAAAGATT TGTTGAGCTC TTTGATTAGA TGCTTTCTTT GTTTGAAAAG
GACAATTAAC CATTGGCTGT AATATTTTTA TATTGACTAT GGAACATCCT TCCATGCGAC TGTTGACTAT GTTTCATGAA
TATTGACACG CGTTATTGAA CTTTTCCAGC TTATCAATCC TGCTGAGACC TTTGGGGACA TTGTGATTGA TTATCCGTAA
GACATTACAA CCCATCCATT GTCCTCTTTT CTTGCTTTGC CATGTAGAAG GTGAACTGAT CTTTCTTTCC TTCTCTCCTT
TGTATGTGTA TAAAATTTAT AGTTATGTGG AATGCACTTC AGCAGCAATT CAGGCCCTGA CAGCATTTAA AAAGCTCTAC
CCTGGACACC GCAAGAGTGA AATAGACAAC TGTATAAGCA AAGCTGCTAG CTTTATTGAG GGTATTCAAA AAAGCGATGG
TTCATGGTTA GTACAAGGAC TTCACATGAA ACAATAAGAA CATTGCGTGC ATATAATTGT CTACATTGTC TACTGCCCTT
GGTCAAAAAA AAAATTGTCT ACATTGTTCA CTCTGTATTT TCCAACAGGT ATGGTTCTTG GGCTGTTTGT TTTACCTATG
GCACATGGTT TGGTGTAAAG GGATTAGTTG CTGCTGGTAG GACATTCAAA AACAGTCCTG CAATCAGAAA GGCATGTGAC
TTTTTGTTGT CAAAAGAGCT TCCTTCTGGA GGCTGGGGAG AAAGCTATTT GTCATCCCAA GATCAGGTAA ATTCATTTCT
ATGAAATTTG CACAATGTTA CTATTCTTTA CTTTTTTTTT TTCTGTATCA TGGATATGCT TTCAATCTTG TTTACTGGAT
CGCATCCATC TATTATAATG TTGATAACCA GGTGCTCTGA TCAATATCAC CTGTTGTTTG GGATAAATGC TTCAAAACAT
GTAAAGTTTT AACAAGTGGA CATGAACTCA TGAGAGAACT TCCCTACAAT CGGGATACAA CTAGAACCTT GTGGTGCTAC
ATTTTGTTGT ACTGGATAGA GTAGGATGCT AAATTTCATG CCATTGCTCT TTTCTGCATG GCGCACAGGT AGGTTATAAT
GTGTTGCAGG GTTCTTTGCT GTTTTTTTGT GCCACCTGCT TAGTCACTTG AATTTCTTCC AGTCTTAAAA GATTAAATTA
GTAGTGACTA CTACCAACAT GCTTTCATAT GTAACAACAA ATGATATATT TTTGGGAATC AACTATTAAG GTGTATTTCT
TTTCTTTGTA ATCCATGTGG CATGTAAGAA TTTTTATACA TATTAGAACA TTACCTTTAC AAATAATATG TTGGACATTG
TCTTGCACAT AGACAGCACT TGAAATACTG TATTGATCAG GTATTGTATT GATTCTTAAT TTACACAGGT TTCATCTTTG
CTTTAACCAT CTCGTGGCTT GTTTTCAAAT AGGTTTATAC CAATCTCGAA GGGAAGCGAC CTCATGCGGT GAACACTGGT
TGGGCCATGC TAGCCCTAAT CGATGCAGGG CAGGTTTGTC TTTTGTTAAA TATATTTTTG TGTATGGTTG ACTTTTCAGT
TATCGTAAAA TGATACATAT GCTTATTCGT GATAGTACTT TCCTCTTGCA GGCTGAGAGA GATCCAATTC CTTTGCATCG
AGCAGCGAAG GTTTTGATCA ACTTACAATC GGAAGATGGT GAATTTCCCC AGCAAGTAAG TTCTAATCCA TCCCATGGGT
TCATGACATG AAACGTTGCT CTAGAAAAGA AAGTGATGCA TTTACTTCAG CCTGTAATAA TCTTGTGGTG ATTCAAACTT
CTGTTTTTAA AAATAGAGCA TTTCATAGAA GTTCCAATGG GCATAAGTAG AAGCACAGAA ATATAGGGTT TAGGTATTGA
CAAGCAATAT AATCTAAACT AATTGACTGA GGGTTGTCCC TTAGTTGCGT GTTTCTAATC ATTAGACTAT TCTAGGCATG
TTATCTAACC GGTCGACCAT AGATCCAAAG TTGCTTGGAA ATTATCCTGA AGTATCATTG CGCAATGTTG TTAAAAGATC
TTTGATGCTA GGGGAACACG CATTGCTTCA CTCGATATTG AACGAGGAAA ACTAAATTGC TGACATGAGT TATCCTTTTC
CTTTCACTAT GTATTATTTA CCATCATCCG AGATGCTAAA TAACATTTTT TACCCCCCCC CCCCCCAACC ATATAACAGG
AGATCATTGG AGTCTTCAAC AAAAACTGCA TGATCAGCTA CTCCGAGTAT AGAAACATCT TCCCTATTTG GGCCCTTGGG
GAGTACCGTC GCCGCGTCTT GGCCGCAGAC AAGTAGTTCA GCACGAGCAG AGCAGCAGCA CCAACAATGT GCATGTATTT
ATACGTGAAA TAATGTAGCT ATGTTTCAGT TGTAATAATG TGGCTATATG TATTCTCCCG TTAGTGATGC CACGCGAGCG
TAGTCAAATA GAAACGCATT TTGACACAAG TTCGAGATGA ATGGATTCCT GAATCGAATG TTTGTGTTCA GATAGAATTC
TTGCCACGCA AAATACAAAC ATGAAAG

Locus: Os02g0139700

Loading...

Locus: Os02g0139700

Loading...