Os02t0143300-00

Locus

Os02g0143300

Description

Similar to SAUR family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

SAUR4

CGSNL Gene Name

SMALL AUXIN-UP RNA 4

Oryzabase Gene Symbol Synonym(s)

OsSAUR4

Oryzabase Gene Name Synonym(s)

Small auxin-up RNA 4

Transcript Evidence

FP092583 (DDBJ)

Protein Evidence

XP_002327252.1 (RefSeq)

Literature

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Functional domain (InterPro)

Auxin responsive SAUR protein (IPR003676)

Expression Databases

TENOR (Os02t0143300-00)

Others

Oryzabase (9129)

Transcript

388 bp

>Os02t0143300-00 Similar to SAUR family protein.
AGAGAAGATTTGATCTTTGATGATGATGGGGTACTTCCGGGCGCCGAGGAGGAAGGCGGC
GGCGGCGGCGGAGGGGGAGAGCGTGCGGGCGGCGCTGCTCGTCGGCGGCGGCGGCGAGGA
GGcggcggtgccgaaggggtacttcgcggtgtacgtgggcgcggaggcgaggcggttcgt
ggtgccgacgagctacctccggcagccggcgttccggggcctcatggagctcgccgccga
cgagttcggcttcgcccaggagggcggcctccgcctcccctgcCGCGAGGAGGACTTCCA
GGCCACCGTCGCCGCGCTCGACGCGCGCCGCCGCCCGGCGAGCGGCGGCGCGATCATGAG
CACCATGGTCAAGGCCAGGTCGTTGTAG

CDS

369 bp

>Os02t0143300-00 Similar to SAUR family protein.
ATGATGATGGGGTACTTCCGGGCGCCGAGGAGGAAGGCGGCGGCGGCGGCGGAGGGGGAG
AGCGTGCGGGCGGCGCTGCTCGTCGGCGGCGGCGGCGAGGAGGcggcggtgccgaagggg
tacttcgcggtgtacgtgggcgcggaggcgaggcggttcgtggtgccgacgagctacctc
cggcagccggcgttccggggcctcatggagctcgccgccgacgagttcggcttcgcccag
gagggcggcctccgcctcccctgcCGCGAGGAGGACTTCCAGGCCACCGTCGCCGCGCTC
GACGCGCGCCGCCGCCCGGCGAGCGGCGGCGCGATCATGAGCACCATGGTCAAGGCCAGG
TCGTTGTAG

Protein

122 aa

>Os02t0143300-00 Similar to SAUR family protein.
MMMGYFRAPRRKAAAAAEGESVRAALLVGGGGEEAAVPKGYFAVYVGAEARRFVVPTSYL
RQPAFRGLMELAADEFGFAQEGGLRLPCREEDFQATVAALDARRRPASGGAIMSTMVKAR
SL*

5'UTR

chr02:2406632..2406650 (+ strand) : 19 bp

CDS

chr02:2406651..2407019 (+ strand) : 369 bp

FASTA

>Os02t0143300-00 class=Sequence position=chr02:2406632..2407019 (+ strand)
AGAGAAGATT TGATCTTTGA TGATGATGGG GTACTTCCGG GCGCCGAGGA GGAAGGCGGC GGCGGCGGCG GAGGGGGAGA
GCGTGCGGGC GGCGCTGCTC GTCGGCGGCG GCGGCGAGGA GGcggcggtg ccgaaggggt acttcgcggt gtacgtgggc
gcggaggcga ggcggttcgt ggtgccgacg agctacctcc ggcagccggc gttccggggc ctcatggagc tcgccgccga
cgagttcggc ttcgcccagg agggcggcct ccgcctcccc tgcCGCGAGG AGGACTTCCA GGCCACCGTC GCCGCGCTCG
ACGCGCGCCG CCGCCCGGCG AGCGGCGGCG CGATCATGAG CACCATGGTC AAGGCCAGGT CGTTGTAG

Locus: Os02g0143300

Loading...

Locus: Os02g0143300

Loading...