Os02t0146500-01

Locus

Os02g0146500

Description

Conserved hypothetical protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK067901 (DDBJ, Best hit)

Protein Evidence

B9F2Q1 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Full-length cDNA

J013125B21 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0146500-01)

Transcript

2668 bp

>Os02t0146500-01 Conserved hypothetical protein.
GCCGCGCTCCCTTCGTTCGTGCGCTTCCTCGGTCGCCGGCGATGGCGATGGCGATGGCGC
CGGCGGTGGTCTCGGGCGAGAGGCTCGTCGTGTTCCTCTTCGTCGCCCGCGTCGCGCTCG
CGGCGCCGGCCCAGCTCGCCGCCCCGCTCGCGGTCCTCGCCGCGGCCGCCCTCGCCGTCG
AGCTCGCCGTGGATGGCTCCGCCTCCGCGTCCTCATCGCCGCTCCGCCGGTTCAGGACCA
GGCCGGGTGCTTCATCAGGCATACTTCTTGGTGCCACTACTCTGCCTAGTGTCATGCTTT
CACGGTTAATTCAACTTTATAGGGTCTTACTAGCAGATCCTAATGGACGTGAAGAATATG
CATACCTTGAAATGCAGTACTGGGCAGTATCTGTTAGCTGCCTTGGCATGTTATCATTTT
TTGTTTGGCATCTACGGCAGTCTCCCAGCAATGGAAATTCTATAGCTTCGAAATACGGCT
TGTTGCTCATCATTTTATATCCCCTGGCATACTTGTTCCACCTTTTACTGAAGACTGATG
GAGGTCTGCTGGTGATGAGTAATTTGGTGTATTTGCTGTGTCATGGAGTGGCTGCTGTGA
TCTTAATCCAGCATATTCTAGAGAAGTTCCCTTCATGTTCATCTTTTGGTTTGTACCTGA
AGTCTAAGATGTAGTTAGATCTTTATTTTTTTGTTTATATCTGACTGCATATGTTTAGAC
TTTAGAGCTATCCATACGATTGCTAGTTATCCTACCAGTTTTCCATGCAGGCATAGTGCA
TTATATCTACACTGTTCATTTTTTAAAATTTAAATTCAGCTAATTTGTGTGGTTCCTATT
GGCCGATGCAATGTATATGTCTCCTTTTCATCATGACTTGAAGCTATTGCTTTTTTTAAC
TTATCTTTACATTTTCTGTGAACTTAGGGGAGGCCATTTTGGTCTCAAGTGGTCTTGTTC
TTTACTGTGGTGATATGCTGGCTCATACTCTTTCAAAGATGGAGTTCTCCGTATCATCAG
AAGCATTTATTCGCGCACCTGGAACTCGAAGCGAGATAGGCACAGTTATTCAGGGGGTTT
TGCTTGGTCTTTTTCTTCTCCCCTTGTTATACAAAAGCTCCCTTCAAGTTTTGGCTTACT
GTAGAAAACTGGAGAGTCAAAGAACACAAACAGTTGAGGAATGCACACAGAAGAGAATTG
ACTGTGGTGTATTTTATGTTTCATTGTTGGTAGCACTATTGTTGTTAGTGCCATCATGGA
CGCGTCTTATTCAAGGTTTTGAAGTGCATCCATTTGTTTGGGTTTTTAACTATATTTTCA
CCGATTCACGTGAACGGCTTGCTTTATGCGCATACTGGATATTTGTGATATATGTATCAA
TTAGAAGGTTCTACAGTATATCAAAACAAAGCAAAACGGAGAGGATTCTTTTGCGCAAGT
ATTACCATCTCGTTGCTGTCCTAATTTTCTCTCCTGCAGTAATATTTCAGCCTGATTTCT
TGGACTTAGCATTTGGTGCAGCATTTGCCGTTTTCTTAATATTGGAGATGGTTCGAGTTT
GGGAAATATACCCTCTTGGGCATATTGTGCATCAGTTCATGAGTGCCTTCACTGATCATC
GCGATTCGGAAATTCTAATTGTTAGTCATTTCTCACTCTTGCTGGGATGTGCACTTCCTA
AATGGATGTCATCAGGATTCAATGACCGACCTCTTACACCATTTGCTGGAATTCTCAGCT
TGGGTATTGGTGATACCATGGCATCAATGATAGGTTATAAGTATGGTGTCCTAAGATGGA
GCAAGACAGGAAAGAAAACAATTGAGGGCACAGCAGCAGGCATAACTTCTGTATTAGCAG
CCTGCTCAATCCTGCTGTCACTCTTAGCTTCAAGTGGATACATACTTTCACAGCATTGGA
TATCACTTTTGGTAGCTGTGACATTGAGCGGTTTATTGGAAGCATATACAGCCCAACTCG
ACAACGCTTTCATACCCCTTGTCTTCTATAGCCTCCTATGTCTATAGGAGCAACCAATTG
TACATCAAACTACCTTGAGGCCCTATTCTTACCATTACTAATATCTAGTGACTAGTGCAG
TACAGTATAGGTATAGCCCTTCGAATTTTTTTTTTAAATCCTCTTATTGGTCGCATTCTC
TGTATTCCTGGACCGAGAAATTGTGTCCATTACTAAAAAGTTGAGTTTAGGTTTAGGAAA
TAAAGATGAAAATATGAAAGGTTGTTTAGTGAATCCTTCAGTAGAGAGCATCTTTGGTAT
GATAGACTTCTGAGCCTATCTGGAGGCATCAATGTATCATGGAAGGTATGTTGTCTTTCA
GAACCAGAACTTCTTCTGCAGGTGGTGAGACCTATTTCACCCCACAACTCCACAAGCAGT
TGGGCAAGAATAGCAAGCTGAGAGTAAAGCCATATGCTGCAAGGAGCCTGAAATACGGAG
ACTTGGTTCAGAATTAATGTATATGGTACCTTATTTCCATGGACATGCGAAGTGTAATTA
GTTGTAGTAGCTAATCTCCTGTAAGTTTTGCGTCATCACTGTACGGAGTAAAAGATCACT
ACTCAGATTGCAACCGCGCATTGATGTAAATTTTGTTCTTGACCTGAGAAAAAATGAAAT
CGAAGTAAGCAAAGCTGCAAATTAATGT

CDS

633 bp

>Os02t0146500-01 Conserved hypothetical protein.
ATGGCGATGGCGATGGCGCCGGCGGTGGTCTCGGGCGAGAGGCTCGTCGTGTTCCTCTTC
GTCGCCCGCGTCGCGCTCGCGGCGCCGGCCCAGCTCGCCGCCCCGCTCGCGGTCCTCGCC
GCGGCCGCCCTCGCCGTCGAGCTCGCCGTGGATGGCTCCGCCTCCGCGTCCTCATCGCCG
CTCCGCCGGTTCAGGACCAGGCCGGGTGCTTCATCAGGCATACTTCTTGGTGCCACTACT
CTGCCTAGTGTCATGCTTTCACGGTTAATTCAACTTTATAGGGTCTTACTAGCAGATCCT
AATGGACGTGAAGAATATGCATACCTTGAAATGCAGTACTGGGCAGTATCTGTTAGCTGC
CTTGGCATGTTATCATTTTTTGTTTGGCATCTACGGCAGTCTCCCAGCAATGGAAATTCT
ATAGCTTCGAAATACGGCTTGTTGCTCATCATTTTATATCCCCTGGCATACTTGTTCCAC
CTTTTACTGAAGACTGATGGAGGTCTGCTGGTGATGAGTAATTTGGTGTATTTGCTGTGT
CATGGAGTGGCTGCTGTGATCTTAATCCAGCATATTCTAGAGAAGTTCCCTTCATGTTCA
TCTTTTGGTTTGTACCTGAAGTCTAAGATGTAG

Protein

211 aa

>Os02t0146500-01 Conserved hypothetical protein.
MAMAMAPAVVSGERLVVFLFVARVALAAPAQLAAPLAVLAAAALAVELAVDGSASASSSP
LRRFRTRPGASSGILLGATTLPSVMLSRLIQLYRVLLADPNGREEYAYLEMQYWAVSVSC
LGMLSFFVWHLRQSPSNGNSIASKYGLLLIILYPLAYLFHLLLKTDGGLLVMSNLVYLLC
HGVAAVILIQHILEKFPSCSSFGLYLKSKM*

5'UTR

chr02:2551636..2551676 (+ strand) : 41 bp

CDS

chr02:2551677..2551876 (+ strand) : 200 bp

chr02:2552723..2552835 (+ strand) : 113 bp

chr02:2552984..2553172 (+ strand) : 189 bp

chr02:2553285..2553415 (+ strand) : 131 bp

3'UTR

chr02:2553416..2553739 (+ strand) : 324 bp

chr02:2553837..2553911 (+ strand) : 75 bp

chr02:2553985..2554211 (+ strand) : 227 bp

chr02:2554363..2554552 (+ strand) : 190 bp

chr02:2554629..2554694 (+ strand) : 66 bp

chr02:2554809..2554897 (+ strand) : 89 bp

chr02:2554992..2555106 (+ strand) : 115 bp

chr02:2555192..2555243 (+ strand) : 52 bp

chr02:2555319..2555419 (+ strand) : 101 bp

chr02:2555518..2556272 (+ strand) : 755 bp

FASTA

>Os02t0146500-01 class=Sequence position=chr02:2551636..2556272 (+ strand)
GCCGCGCTCC CTTCGTTCGT GCGCTTCCTC GGTCGCCGGC GATGGCGATG GCGATGGCGC CGGCGGTGGT CTCGGGCGAG
AGGCTCGTCG TGTTCCTCTT CGTCGCCCGC GTCGCGCTCG CGGCGCCGGC CCAGCTCGCC GCCCCGCTCG CGGTCCTCGC
CGCGGCCGCC CTCGCCGTCG AGCTCGCCGT GGATGGCTCC GCCTCCGCGT CCTCATCGCC GCTCCGCCGG TTCAGGACCA
GGTGCGACGT TATATCCTCC CCCCCGCTCT TATCCGTATC TTCTTCCGCC GCATCTCCAC GGAGCTGGGC TGCTAGTTCG
CGCGATTTGG TTAGCTCGGG GGATTGCGCG ATCTTGATAC CAGTGTTCGA GTTTCAAACT CCACGAATTA AGTGTTCGAG
GAGCTCCCTG TGATGTCAGG GAACCTGCGA GGTGCAGTGT TTTGCAAAAT TCGTTGGCGC AGCCGTAGAA TCTGAGGCGA
ATTGATCCAT TTGTTGGTTC AGTGCTGGCT GCCTCCCTGT GAGGATCATG CAATTGGGGA AACGACATCA GTCGGATTCA
GCATTCCGCA GGAATGCGAT TTTACTTGTA CTTGAGGCTT ACTGAATTTT CTTTTGGTTC AGTAGTGTGT AAAATGGTCA
GGTTTTGGTG GTTCCAAGAA TCCAAGGGAC AAATATCACT CTTGAATAAT TGGGTTTCAG CATTTCTTAG TTGACCCATT
TCACAAATGG TAAATTCAGA GGTGCTTCTA TCATACAGCC AGTCAAAATA TTGCTCTCAT TTTGATGGCC AAAATAATGT
TCCATTGCAT TTTCAGCTAA AACGTTGCTC CCACTGTCAT TTATATGGGT tcttttatgc aatgacaatt caggtgggga
atctctcccc cccCCCCCCC CCCCCCCGGT GAGTTAGTCA AAAAATTTAT ATGGGTTCTG TGATGTGCAA TCCTAGTTGC
TTACTGTAAG ATTTTATCAC GTCTTGTGTT GTGAGGACTT CACCTTCTTG TGGTGGCTTG ATGCTCTTGT GCATGTTTCT
GTAAAAGATT GTTAAGTGCT TGATGATGAT ATATGTATAT GCTCCAGGCC GGGTGCTTCA TCAGGCATAC TTCTTGGTGC
CACTACTCTG CCTAGTGTCA TGCTTTCACG GTTAATTCAA CTTTATAGGG TCTTACTAGC AGATCCTAAT GGACGTGAAG
GTATCCATTT TTCTATTTTG TCAAATTTAT CAGATCCACT GCTAAATGGA AATTTCCCTA AATCTTCATC AACATTTCAA
ATCTTGTTTG ACACTAAGAT TTTCGGTGAC GCATCTGGTT TACTAACTAC ATATGTGTTC ATTGTCAGAA TATGCATACC
TTGAAATGCA GTACTGGGCA GTATCTGTTA GCTGCCTTGG CATGTTATCA TTTTTTGTTT GGCATCTACG GCAGTCTCCC
AGCAATGGAA ATTCTATAGC TTCGAAATAC GGCTTGTTGC TCATCATTTT ATATCCCCTG GCATACTTGT TCCACCTTTT
ACTGAAGACT GATGGAGGTA CATGCATATT TTATCTGCAT GCAAACATAA TCTCACCCTT TCTTTCCAAA ATCTGGTGGA
AGTTCATCAG AAGCAAGGAA TTACAAACTA ATCTAGGTTG TCTTAACAGG TCTGCTGGTG ATGAGTAATT TGGTGTATTT
GCTGTGTCAT GGAGTGGCTG CTGTGATCTT AATCCAGCAT ATTCTAGAGA AGTTCCCTTC ATGTTCATCT TTTGGTTTGT
ACCTGAAGTC TAAGATGTAG TTAGATCTTT ATTTTTTTGT TTATATCTGA CTGCATATGT TTAGACTTTA GAGCTATCCA
TACGATTGCT AGTTATCCTA CCAGTTTTCC ATGCAGGCAT AGTGCATTAT ATCTACACTG TTCATTTTTT AAAATTTAAA
TTCAGCTAAT TTGTGTGGTT CCTATTGGCC GATGCAATGT ATATGTCTCC TTTTCATCAT GACTTGAAGC TATTGCTTTT
TTTAACTTAT CTTTACATTT TCTGTGAACT TAGGGGAGGC CATTTTGGTC TCAAGTGGTC TTGTTCTTTA CTGTGGTGAT
ATGCTGGCTC ATACTCTTTC AAAGGTGTGA TTTATTCCTC GAACTATGTT TTACCAGCAA AATGGTAGCA AATCTGATAC
TTATTTTGTT GCCTGCACAT TTGCAACCGT GCTGCTGGCA GATGGAGTTC TCCGTATCAT CAGAAGCATT TATTCGCGCA
CCTGGAACTC GAAGCGAGAT AGGCACAGTT ATTCAGGTAG AAGCTATTGC GTTCTCTGGC TTCAGTTTCT TAGTGCATAA
TACCCTTCCC TTTTTTTTCT TTTCTGCAGG GGGTTTTGCT TGGTCTTTTT CTTCTCCCCT TGTTATACAA AAGCTCCCTT
CAAGTTTTGG CTTACTGTAG AAAACTGGAG AGTCAAAGAA CACAAACAGT TGAGGAATGC ACACAGAAGA GAATTGACTG
TGGTGTATTT TATGTTTCAT TGTTGGTAGC ACTATTGTTG TTAGTGCCAT CATGGACGCG TCTTATTCAA GGTTTTGAAG
TGCATCCATT TGTTTGGTGA GCATATAAGT TTGCATTTCA TTGGAAGGGC ATAAAAGCAT GCACTCTGTT AGTCAAATAT
TGAAAAATTT CTTCCTGTGT TGCTTCTAAA CCTTGTGCAT TTTTGTACGT ATTGAATTTT GGTTCACTTA ATGGTTTATA
TTCACAGGGT TTTTAACTAT ATTTTCACCG ATTCACGTGA ACGGCTTGCT TTATGCGCAT ACTGGATATT TGTGATATAT
GTATCAATTA GAAGGTTCTA CAGTATATCA AAACAAAGCA AAACGGAGAG GATTCTTTTG CGCAAGTATT ACCATCTCGT
TGCTGTCCTA ATTTTCTCTC CTGCAGTAAT ATTTCAGGTA ATATATGTTT TCGATATTCG ATCCCCATCA GATTGTTTGA
AACACACTCT CAATAAATTG TTTCTCTTTG CAGCCTGATT TCTTGGACTT AGCATTTGGT GCAGCATTTG CCGTTTTCTT
AATATTGGAG ATGGTTCGAG TAAGCATTTT CTTTATTTGT GTCCCTTTCT TTTCCCCCCT CTTTCTGTTT TTTGGCAGTT
TGTATGCCCA CATGTGCTAA TTTCTCCGAC GAAATGTTTC ACTCTGACCT CAGGTTTGGG AAATATACCC TCTTGGGCAT
ATTGTGCATC AGTTCATGAG TGCCTTCACT GATCATCGCG ATTCGGAAAT TCTAATTGTT AGGTAGGTCT GGATTAATGG
TCGTTGTTTT CCAGATTTTA ACTCATTTAC ATGTTCAGTG CTTGGATAGG CCTAATACTA TATTTGTTTT GTTCAGTCAT
TTCTCACTCT TGCTGGGATG TGCACTTCCT AAATGGATGT CATCAGGATT CAATGACCGA CCTCTTACAC CATTTGCTGG
AATTCTCAGC TTGGGTATTG GTGATACCAT GGTAGGTTCT ATGTCCAGTG CGTGATCAGT TAATATTTTC TTATGTTAGC
TGCGTTCAGT ATGATGAATT CTCTTGTTTT ACCTAGGCAT CAATGATAGG TTATAAGTAT GGTGTCCTAA GATGGAGCAA
GACAGGAAGT GAGTTTAATT TCCATTATTA TTTATTCCAT GATTGATAAT TGATCTCTTA TGCACATACT TTTGAAATGT
TAGAGAAAAC AATTGAGGGC ACAGCAGCAG GCATAACTTC TGTATTAGCA GCCTGCTCAA TCCTGCTGTC ACTCTTAGCT
TCAAGTGGAT ACATACTTTC ACAGGTTTTA CTTCCCCCCC TGGCATTAAA CCATTTGAAG CTTTTATTCT ACAATATACT
AAGCAAGCAT AAATCCTGAC CATCTCTTTT ATATTAACAC AGCATTGGAT ATCACTTTTG GTAGCTGTGA CATTGAGCGG
TTTATTGGAA GCATATACAG CCCAACTCGA CAACGCTTTC ATACCCCTTG TCTTCTATAG CCTCCTATGT CTATAGGAGC
AACCAATTGT ACATCAAACT ACCTTGAGGC CCTATTCTTA CCATTACTAA TATCTAGTGA CTAGTGCAGT ACAGTATAGG
TATAGCCCTT CGAATTTTTT TTTTAAATCC TCTTATTGGT CGCATTCTCT GTATTCCTGG ACCGAGAAAT TGTGTCCATT
ACTAAAAAGT TGAGTTTAGG TTTAGGAAAT AAAGATGAAA ATATGAAAGG TTGTTTAGTG AATCCTTCAG TAGAGAGCAT
CTTTGGTATG ATAGACTTCT GAGCCTATCT GGAGGCATCA ATGTATCATG GAAGGTATGT TGTCTTTCAG AACCAGAACT
TCTTCTGCAG GTGGTGAGAC CTATTTCACC CCACAACTCC ACAAGCAGTT GGGCAAGAAT AGCAAGCTGA GAGTAAAGCC
ATATGCTGCA AGGAGCCTGA AATACGGAGA CTTGGTTCAG AATTAATGTA TATGGTACCT TATTTCCATG GACATGCGAA
GTGTAATTAG TTGTAGTAGC TAATCTCCTG TAAGTTTTGC GTCATCACTG TACGGAGTAA AAGATCACTA CTCAGATTGC
AACCGCGCAT TGATGTAAAT TTTGTTCTTG ACCTGAGAAA AAATGAAATC GAAGTAAGCA AAGCTGCAAA TTAATGT

Locus: Os02g0146500

Loading...

Locus: Os02g0146500

Loading...