Os02t0146500-02

Locus

Os02g0146500

Description

Similar to cDNA clone:J013125B21, full insert sequence.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK060195 (DDBJ, Best hit)

Protein Evidence

B7EE59 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Full-length cDNA

001-001-F01 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0146500-02)

Transcript

1824 bp

>Os02t0146500-02 Similar to cDNA clone:J013125B21, full insert sequence.
GAACACAAACAGTTGAGGAATGCACACAGAAGAGAATTGACTGTGGTGTATTTTATGTTT
CATTGTTGGTAGCACTATTGTTGTTAGTGCCATCATGGACGCGTCTTATTCAAGGTTTTG
AAGTGCATCCATTTGTTTGGTGAGCATATAAGTTTGCATTTCATTGGAAGGGCATAAAAG
CATGCACTCTGTTAGTCAAATATTGAAAAATTTCTTCCTGTGTTGCTTCTAAACCTTGTG
CATTTTTGTACGTATTGAATTTTGGTTCACTTAATGGTTTATATTCACAGGGTTTTTAAC
TATATTTTCACCGATTCACGTGAACGGCTTGCTTTATGCGCATACTGGATATTTGTGATA
TATGTATCAATTAGAAGGTTCTACAGTATATCAAAACAAAGCAAAACGGAGAGGATTCTT
TTGCGCAAGTATTACCATCTCGTTGCTGTCCTAATTTTCTCTCCTGCAGTAATATTTCAG
CCTGATTTCTTGGACTTAGCATTTGGTGCAGCATTTGCCGTTTTCTTAATATTGGAGATG
GTTCGAGTTTGGGAAATATACCCTCTTGGGCATATTGTGCATCAGTTCATGAGTGCCTTC
ACTGATCATCGCGATTCGGAAATTCTAATTGTTAGTCATTTCTCACTCTTGCTGGGATGT
GCACTTCCTAAATGGATGTCATCAGGATTCAATGACCGACCTCTTACACCATTTGCTGGA
ATTCTCAGCTTGGGTATTGGTGATACCATGGTAGGTTCTATGTCCAGTGCGTGATCAGTT
AATATTTTCTTATGTTAGCTGCGTTCAGTATGATGAATTCTCTTGTTTTACCTAGGCATC
AATGATAGGTTATAAGTATGGTGTCCTAAGATGGAGCAAGACAGGAAGTGAGTTTAATTT
CCATTATTATTTATTCCATGATTGATAATTGATCTCTTATGCACATACTTTTGAAATGTT
AGAGAAAACAATTGAGGGCACAGCAGCAGGCATAACTTCTGTATTAGCAGCCTGCTCAAT
CCTGCTGTCACTCTTAGCTTCAAGTGGATACATACTTTCACAGCATTGGATATCACTTTT
GGTAGCTGTGACATTGAGCGGTTTATTGGAAGCATATACAGCCCAACTCGACAACGCTTT
CATACCCCTTGTCTTCTATAGCCTCCTATGTCTATAGGAGCAACCAATTGTACATCAAAC
TACCTTGAGGCCCTATTCTTACCATTACTAATATCTAGTGACTAGTGCAGTACAGTATAG
GTATAGCCCTTCGAATTTTTTTTTTAAATCCTCTTATTGGTCGCATTCTCTGTATTCCTG
GACCGAGAAATTGTGTCCATTACTAAAAAGTTGAGTTTAGGTTTAGGAAATAAAGATGAA
AATATGAAAGGTTGTTTAGTGAATCCTTCAGTAGAGAGCATCTTTGGTATGATAGACTTC
TGAGCCTATCTGGAGGCATCAATGTATCATGGAAGGTATGTTGTCTTTCAGAACCAGAAC
TTCTTCTGCAGGTGGTGAGACCTATTTCACCCCACAACTCCACAAGCAGTTGGGCAAGAA
TAGCAAGCTGAGAGTAAAGCCATATGCTGCAAGGAGCCTGAAATACGGAGACTTGGTTCA
GAATTAATGTATATGGTACCTTATTTCCATGGACATGCGAAGTGTAATTAGTTGTAGTAG
CTAATCTCCTGTAAGTTTTGCGTCATCACTGTACGGAGTAAAAGATCACTACTCAGATTG
CAACCGCGCATTGATGTAAATTTTGTTCTTGACCTGAGAAAAAATGAAATCGAAGTAAGC
AAAGCTGCAAATTAATGTTCTCTT

CDS

516 bp

>Os02t0146500-02 Similar to cDNA clone:J013125B21, full insert sequence.
ATTTTGGTTCACTTAATGGTTTATATTCACAGGGTTTTTAACTATATTTTCACCGATTCA
CGTGAACGGCTTGCTTTATGCGCATACTGGATATTTGTGATATATGTATCAATTAGAAGG
TTCTACAGTATATCAAAACAAAGCAAAACGGAGAGGATTCTTTTGCGCAAGTATTACCAT
CTCGTTGCTGTCCTAATTTTCTCTCCTGCAGTAATATTTCAGCCTGATTTCTTGGACTTA
GCATTTGGTGCAGCATTTGCCGTTTTCTTAATATTGGAGATGGTTCGAGTTTGGGAAATA
TACCCTCTTGGGCATATTGTGCATCAGTTCATGAGTGCCTTCACTGATCATCGCGATTCG
GAAATTCTAATTGTTAGTCATTTCTCACTCTTGCTGGGATGTGCACTTCCTAAATGGATG
TCATCAGGATTCAATGACCGACCTCTTACACCATTTGCTGGAATTCTCAGCTTGGGTATT
GGTGATACCATGGTAGGTTCTATGTCCAGTGCGTGA

Protein

172 aa

>Os02t0146500-02 Similar to cDNA clone:J013125B21, full insert sequence.
ILVHLMVYIHRVFNYIFTDSRERLALCAYWIFVIYVSIRRFYSISKQSKTERILLRKYYH
LVAVLIFSPAVIFQPDFLDLAFGAAFAVFLILEMVRVWEIYPLGHIVHQFMSAFTDHRDS
EILIVSHFSLLLGCALPKWMSSGFNDRPLTPFAGILSLGIGDTMVGSMSSA*

5'UTR

chr02:2554073..2554330 (+ strand) : 258 bp

CDS

chr02:2554331..2554552 (+ strand) : 222 bp

chr02:2554629..2554694 (+ strand) : 66 bp

chr02:2554809..2554897 (+ strand) : 89 bp

chr02:2554992..2555130 (+ strand) : 139 bp

3'UTR

chr02:2555131..2555419 (+ strand) : 289 bp

chr02:2555518..2556278 (+ strand) : 761 bp

FASTA

>Os02t0146500-02 class=Sequence position=chr02:2554073..2556278 (+ strand)
GAACACAAAC AGTTGAGGAA TGCACACAGA AGAGAATTGA CTGTGGTGTA TTTTATGTTT CATTGTTGGT AGCACTATTG
TTGTTAGTGC CATCATGGAC GCGTCTTATT CAAGGTTTTG AAGTGCATCC ATTTGTTTGG TGAGCATATA AGTTTGCATT
TCATTGGAAG GGCATAAAAG CATGCACTCT GTTAGTCAAA TATTGAAAAA TTTCTTCCTG TGTTGCTTCT AAACCTTGTG
CATTTTTGTA CGTATTGAAT TTTGGTTCAC TTAATGGTTT ATATTCACAG GGTTTTTAAC TATATTTTCA CCGATTCACG
TGAACGGCTT GCTTTATGCG CATACTGGAT ATTTGTGATA TATGTATCAA TTAGAAGGTT CTACAGTATA TCAAAACAAA
GCAAAACGGA GAGGATTCTT TTGCGCAAGT ATTACCATCT CGTTGCTGTC CTAATTTTCT CTCCTGCAGT AATATTTCAG
GTAATATATG TTTTCGATAT TCGATCCCCA TCAGATTGTT TGAAACACAC TCTCAATAAA TTGTTTCTCT TTGCAGCCTG
ATTTCTTGGA CTTAGCATTT GGTGCAGCAT TTGCCGTTTT CTTAATATTG GAGATGGTTC GAGTAAGCAT TTTCTTTATT
TGTGTCCCTT TCTTTTCCCC CCTCTTTCTG TTTTTTGGCA GTTTGTATGC CCACATGTGC TAATTTCTCC GACGAAATGT
TTCACTCTGA CCTCAGGTTT GGGAAATATA CCCTCTTGGG CATATTGTGC ATCAGTTCAT GAGTGCCTTC ACTGATCATC
GCGATTCGGA AATTCTAATT GTTAGGTAGG TCTGGATTAA TGGTCGTTGT TTTCCAGATT TTAACTCATT TACATGTTCA
GTGCTTGGAT AGGCCTAATA CTATATTTGT TTTGTTCAGT CATTTCTCAC TCTTGCTGGG ATGTGCACTT CCTAAATGGA
TGTCATCAGG ATTCAATGAC CGACCTCTTA CACCATTTGC TGGAATTCTC AGCTTGGGTA TTGGTGATAC CATGGTAGGT
TCTATGTCCA GTGCGTGATC AGTTAATATT TTCTTATGTT AGCTGCGTTC AGTATGATGA ATTCTCTTGT TTTACCTAGG
CATCAATGAT AGGTTATAAG TATGGTGTCC TAAGATGGAG CAAGACAGGA AGTGAGTTTA ATTTCCATTA TTATTTATTC
CATGATTGAT AATTGATCTC TTATGCACAT ACTTTTGAAA TGTTAGAGAA AACAATTGAG GGCACAGCAG CAGGCATAAC
TTCTGTATTA GCAGCCTGCT CAATCCTGCT GTCACTCTTA GCTTCAAGTG GATACATACT TTCACAGGTT TTACTTCCCC
CCCTGGCATT AAACCATTTG AAGCTTTTAT TCTACAATAT ACTAAGCAAG CATAAATCCT GACCATCTCT TTTATATTAA
CACAGCATTG GATATCACTT TTGGTAGCTG TGACATTGAG CGGTTTATTG GAAGCATATA CAGCCCAACT CGACAACGCT
TTCATACCCC TTGTCTTCTA TAGCCTCCTA TGTCTATAGG AGCAACCAAT TGTACATCAA ACTACCTTGA GGCCCTATTC
TTACCATTAC TAATATCTAG TGACTAGTGC AGTACAGTAT AGGTATAGCC CTTCGAATTT TTTTTTTAAA TCCTCTTATT
GGTCGCATTC TCTGTATTCC TGGACCGAGA AATTGTGTCC ATTACTAAAA AGTTGAGTTT AGGTTTAGGA AATAAAGATG
AAAATATGAA AGGTTGTTTA GTGAATCCTT CAGTAGAGAG CATCTTTGGT ATGATAGACT TCTGAGCCTA TCTGGAGGCA
TCAATGTATC ATGGAAGGTA TGTTGTCTTT CAGAACCAGA ACTTCTTCTG CAGGTGGTGA GACCTATTTC ACCCCACAAC
TCCACAAGCA GTTGGGCAAG AATAGCAAGC TGAGAGTAAA GCCATATGCT GCAAGGAGCC TGAAATACGG AGACTTGGTT
CAGAATTAAT GTATATGGTA CCTTATTTCC ATGGACATGC GAAGTGTAAT TAGTTGTAGT AGCTAATCTC CTGTAAGTTT
TGCGTCATCA CTGTACGGAG TAAAAGATCA CTACTCAGAT TGCAACCGCG CATTGATGTA AATTTTGTTC TTGACCTGAG
AAAAAATGAA ATCGAAGTAA GCAAAGCTGC AAATTAATGT TCTCTT

Locus: Os02g0146500

Loading...

Locus: Os02g0146500

Loading...