Os02t0148100-01

Locus

Os02g0148100

Description

TEY-type mitogen-activated protein kinase (MAPK), Regulation of seed dormancy, Defense signal transduction, Osmotic homeostasis, Negative role in salt tolerance

RAP-DB Gene Symbol Synonym(s)

OsMAPK14, OsMPK3, OsMAPK33

RAP-DB Gene Name Synonym(s)

MAP kinase 14, Mitogen-activated Protein Kinase 3, mitogen-activated protein kinase 33

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsMAPK33, OsMPK14, OsMAPK2, OsMAP3, OsMPK14, OsMPK3, MAPK33, MPK14, MAPK2, MAP3, MPK14, MPK3

Oryzabase Gene Name Synonym(s)

MAP kinase 14

Transcript Evidence

AK119650

Protein Evidence

Q6Z437

Literature

PMID: 30671680

PMID: 24777821

PMID: 21451255

Note

Manual Curation

October 13, 2020

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: MAP kinase activity (GO:0004707)

Molecular Function: ATP binding (GO:0005524)

Functional domain (InterPro)

Protein kinase-like domain superfamily (IPR011009)

Protein kinase domain (IPR000719)

Protein kinase, ATP binding site (IPR017441)

Mitogen-activated protein (MAP) kinase, conserved site (IPR003527)

Serine/threonine-protein kinase, active site (IPR008271)

Experimentally confirmed subcellular location

cytoplasm (GO:0005737)

nucleus (GO:0005634)

Full-length cDNA

002-130-G10 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0148100-01)

RiceXPro (AK119650)

Others

Oryzabase (9462)

KEGG (Os02t0148100-01 (EC:2.7.11.24))

Transcript

1549 bp

>Os02t0148100-01 TEY-type mitogen-activated protein kinase (MAPK), Regulation of seed dormancy, Defense signal transduction, Osmotic homeostasis, Negative role in salt tolerance
ATCCACACCTCACGGGAAGCTGTCCCTTCTCCTCTTCTCCTCCTCGGCTGCGGCCACGGC
GACGACGACGACGACGAATTCGAGCGAGGCGATCGGCGATGGAGGCGGTGGCGATCTGAT
CCGCTCTTCCCGTCTCGGCCTCGCGCTCCTCTCCCTCCCTCGCGGTGTCTCGGGTAGGAA
ATGGCGATCATGGTGGATCCTCCAAATGGGATGGGTAACCAAGGGAAGTATTACTACTCG
ATGTGGCAAACTTTGTTTGAGATAGACACTAAGTATGTGCCAATCAAGCCCATCGGGCGA
GGAGCTTATGGGATTGTTTGTTCATCCATAAATCGTGAGACCAACGAGAAAGTAGCAATA
AAGAAGATACACAATGTTTTTGACAACCGTGTTGATGCACTAAGGACTTTGCGGGAGCTG
AAACTTCTCCGGCATCTCCGCCATGAGAATGTTATTGCTTTGAAGGATATAATGATGCCA
GTACACAGGAGGAGTTTTAAAGATGTGTACTTAGTTTATGAACTCATGGATACTGACCTG
CATCAGATAATCAAGTCACCTCAGGGTCTTTCCAATGATCACTGCCAATATTTTCTTTTT
CAGTTGCTTCGAGGACTGAAATATCTCCATTCAGCAGAGATACTCCACAGAGACCTGAAA
CCTGGAAATCTACTGGTTAATGCAAACTGTGATCTCAAGATATGTGATTTTGGTCTTGCA
CGCACAAACAGTAGTAAAGGTCAGTTTATGACTGAGTATGTTGTCACCCGCTGGTATAGA
GCTCCTGAGTTGCTCCTTTGCTGTGACAACTATGGCACTTCCATTGATGTTTGGTCTGTT
GGTTGCATCTTCGCTGAGCTACTTGGTCGGAAACCTATTTTCCCAGGAACTGAGTGCCTA
AATCAGCTCAAGCTCATTGTCAATGTTCTTGGCACCATGAGCGAGTCTGACTTGGAGTTC
ATTGACAACCCAAAAGCTCGCAGATATATCAAATCCCTCCCCTACACTCCCGGTGTGCCC
CTCGCGAGTATGTATCCGCATGCACACCCTCTTGCCATTGATCTTTTACAGAAGATGCTC
ATATTTGATCCTACCAAAAGAATCAGTGTCACCGAGGCTCTTGAGCACCCTTACATGTCC
CCTCTGTATGATCCAAGTGCAAATCCTCCCGCGCAAGTGCCTATCGATCTGGACATAGAC
GAGAACATCAGTGCAGATATGATCAGGGAAATGATGTGGCACGAGATGCTCCACTACCAC
CCTGAAGTTGTTGCAGCAATGAGTGCCCGATGATCTTCAACTGTCCCCAGGAACTTTGCA
GGCTCACTTTTTTTTCTTCTTCTAAAAGCCTACGGCGATTATCGCACCTATTAAGTAACC
AAGACGTGCAAGACTTATTTCATGTATATATGAGCGAAATAAGAACGTTGTTGTATCCAT
ATAGTTCATGTTATGGACCATTACTTGGTGTATGCATTTCACATTTCCACTGGACAGTTA
TGTTGTTGTACTAGTTCATGATGAGAAGTGCTATTAAAGTGAATTCAGT

CDS

1113 bp

>Os02t0148100-01 TEY-type mitogen-activated protein kinase (MAPK), Regulation of seed dormancy, Defense signal transduction, Osmotic homeostasis, Negative role in salt tolerance
ATGGCGATCATGGTGGATCCTCCAAATGGGATGGGTAACCAAGGGAAGTATTACTACTCG
ATGTGGCAAACTTTGTTTGAGATAGACACTAAGTATGTGCCAATCAAGCCCATCGGGCGA
GGAGCTTATGGGATTGTTTGTTCATCCATAAATCGTGAGACCAACGAGAAAGTAGCAATA
AAGAAGATACACAATGTTTTTGACAACCGTGTTGATGCACTAAGGACTTTGCGGGAGCTG
AAACTTCTCCGGCATCTCCGCCATGAGAATGTTATTGCTTTGAAGGATATAATGATGCCA
GTACACAGGAGGAGTTTTAAAGATGTGTACTTAGTTTATGAACTCATGGATACTGACCTG
CATCAGATAATCAAGTCACCTCAGGGTCTTTCCAATGATCACTGCCAATATTTTCTTTTT
CAGTTGCTTCGAGGACTGAAATATCTCCATTCAGCAGAGATACTCCACAGAGACCTGAAA
CCTGGAAATCTACTGGTTAATGCAAACTGTGATCTCAAGATATGTGATTTTGGTCTTGCA
CGCACAAACAGTAGTAAAGGTCAGTTTATGACTGAGTATGTTGTCACCCGCTGGTATAGA
GCTCCTGAGTTGCTCCTTTGCTGTGACAACTATGGCACTTCCATTGATGTTTGGTCTGTT
GGTTGCATCTTCGCTGAGCTACTTGGTCGGAAACCTATTTTCCCAGGAACTGAGTGCCTA
AATCAGCTCAAGCTCATTGTCAATGTTCTTGGCACCATGAGCGAGTCTGACTTGGAGTTC
ATTGACAACCCAAAAGCTCGCAGATATATCAAATCCCTCCCCTACACTCCCGGTGTGCCC
CTCGCGAGTATGTATCCGCATGCACACCCTCTTGCCATTGATCTTTTACAGAAGATGCTC
ATATTTGATCCTACCAAAAGAATCAGTGTCACCGAGGCTCTTGAGCACCCTTACATGTCC
CCTCTGTATGATCCAAGTGCAAATCCTCCCGCGCAAGTGCCTATCGATCTGGACATAGAC
GAGAACATCAGTGCAGATATGATCAGGGAAATGATGTGGCACGAGATGCTCCACTACCAC
CCTGAAGTTGTTGCAGCAATGAGTGCCCGATGA

Protein

371 aa

>Os02t0148100-01 TEY-type mitogen-activated protein kinase (MAPK), Regulation of seed dormancy, Defense signal transduction, Osmotic homeostasis, Negative role in salt tolerance
MAIMVDPPNGMGNQGKYYYSMWQTLFEIDTKYVPIKPIGRGAYGIVCSSINRETNEKVAI
KKIHNVFDNRVDALRTLRELKLLRHLRHENVIALKDIMMPVHRRSFKDVYLVYELMDTDL
HQIIKSPQGLSNDHCQYFLFQLLRGLKYLHSAEILHRDLKPGNLLVNANCDLKICDFGLA
RTNSSKGQFMTEYVVTRWYRAPELLLCCDNYGTSIDVWSVGCIFAELLGRKPIFPGTECL
NQLKLIVNVLGTMSESDLEFIDNPKARRYIKSLPYTPGVPLASMYPHAHPLAIDLLQKML
IFDPTKRISVTEALEHPYMSPLYDPSANPPAQVPIDLDIDENISADMIREMMWHEMLHYH
PEVVAAMSAR*

5'UTR

chr02:2646187..2646360 (- strand) : 174 bp

chr02:2645468..2645473 (- strand) : 6 bp

CDS

chr02:2645045..2645467 (- strand) : 423 bp

chr02:2643312..2644001 (- strand) : 690 bp

3'UTR

chr02:2643056..2643311 (- strand) : 256 bp

FASTA

>Os02t0148100-01 class=Sequence position=chr02:2643056..2646360 (- strand)
ATCCACACCT CACGGGAAGC TGTCCCTTCT CCTCTTCTCC TCCTCGGCTG CGGCCACGGC GACGACGACG ACGACGAATT
CGAGCGAGGC GATCGGCGAT GGAGGCGGTG GCGATCTGAT CCGCTCTTCC CGTCTCGGCC TCGCGCTCCT CTCCCTCCCT
CGCGGTGTCT CGGGGTGAGG GGAATCTTTT GTTTTTGTTT TTTTTGACCG TACTGTTCTG GCTGGGTGTT TCTTGGTCGT
GGTCCAAGAT CGGCGGGTGG TTTGTTTGTC CGGGCTCCAT GGATCGATCT CTCTCTGTTG ATCTGTGTAG CTGGAGAAGC
TCAGCTCCGT GGGAGGATTA CGCGCGCGTG ATTGGTTGGG CTGTGTGTAA ATTTGGTTGC CGGCCATTTT TGTGCTCCGG
TGGTGAATTT GGGTGGTGAG GCTGTCTGCA CAATCCGTGG CGATGAGCTG GGAAATGTGA TGGGGGTGTG CTCGTATCGG
GATGATGGTG GGTTGTTTGG TTGACCCGGA TGAGTGATGA TGATTCACAA TCTTGCATCC ATGAACCGTG GGATGGGTGT
CCATGTCTTT CTCCGGGATT GGGAATTGGT ACCACCACCA TGGCGGTTCT AAAGGCGGGA GGAGATAAAT GCAGGCGGCA
ATGCATGCTT GGTGATGGAG CATCTGTATG AGTGTGCGGG GATCGATGCT CCATGTTCAT TCAGAACCAT AGCCGAGCAA
CTGAAAGCTC ATCTTGAAGA CTGGGACTGC GTTTAATTTA TAGCTCATCT TTGATTACAA AGTTGTTTGA TCTTCTGCAT
TCATAGATAG TTTGGCAGTT GTGTAAGCTC AAAAAGCCGT TGTTATTTCC TAAGGTAGTA CTAACTTATT TTCTTTTGTT
TCCTTAGTAG GAAATGGCGA TCATGGTGGA TCCTCCAAAT GGGATGGGTA ACCAAGGGAA GTATTACTAC TCGATGTGGC
AAACTTTGTT TGAGATAGAC ACTAAGTATG TGCCAATCAA GCCCATCGGG CGAGGAGCTT ATGGGATTGT TTGTTCATCC
ATAAATCGTG AGACCAACGA GAAAGTAGCA ATAAAGAAGA TACACAATGT TTTTGACAAC CGTGTTGATG CACTAAGGAC
TTTGCGGGAG CTGAAACTTC TCCGGCATCT CCGCCATGAG AATGTTATTG CTTTGAAGGA TATAATGATG CCAGTACACA
GGAGGAGTTT TAAAGATGTG TACTTAGTTT ATGAACTCAT GGATACTGAC CTGCATCAGA TAATCAAGTC ACCTCAGGGT
CTTTCCAATG ATCACTGCCA ATATTTTCTT TTTCAGGTAA TACCTGGACC TCTCTTTTCT ATTCTATTCT ACATTTACTT
ACTCAAGAGT AATTGTGTGT TTTTAATGGC CCTTGATGAT TGCTTAGAAT TTGTGACAGT GCATCTTATA TCGGCAAGCC
TCATCCAGTC TTATAAGATG GTTCATTCCC AAATGCACGA GGCACAATCT TAACTTGAAT GGTTCTTCTG TCAGTTAAAA
CTTCAAAGTC AAACTGATTT TTTAAACATG TAAAATTGTG AATGTTTTGC TTCAGCAATG ATTTGTGAGC ATGTCAATGA
CAATACTTTT TTGAGTAATG TATTCCTAAT TTGAAATAAC CAATGTAACT TGTAGTATCA TTCAGTTTGA TTCCAGTTGA
TTTGATGTTT TTGCATTAGT AGTATTTGAA AAAAACTGAA AAAATGGCCT ACTATATTTA TTCCAACCCA GATTCCAACA
GTTTAGACTG ATAATAAATA GATGGAAGGC AAAACTATAT CCCTGTAGTC TGCAGCTTTG AGACAAACTA AACTACACAC
TTTGTGCATT AAGTATTGCC ATCATGATTC CTCTTTTTAT ACATTTTATT TTAATTTGTA GAGTTGAACA TTTATTTTCA
TGTGTCACAG GCACAACATC CATGCATTCC CTTGTTGCCT CATCAAGTAC ATAAAAAAGC AGCTATTCTA ATGTCCGTTC
AACCTAAAAC TGGAACTGGA ACCATCTAGC CCTTTTTAGA TTTCCATCTA TTCTAACTTA TTTTATTAAT TTCGTTAAAC
CACATTTCCA TTAAGAATTT CATATACAGT TCATAATCTA AAACCTAGAT CTTCTTTCAA ATAGTTCTGC ATAGAGGCTT
CTGCATGAAA CCACACAAGT AGACCCTCTT GTTTACAAGA CATAAATATT TTTCTGATGA ATTGTCTGTT CATCCTACCC
TTCAGATTCA TTTATTCTGT TGTCTTGAGT TCATTTTGGA TTGTCTACCA TGTATTTCTT ATTTTTTGCA ATCCGTATTT
TCCAGATGAT TTAAGAGAAT GTTGTTTTCT TGATTGTAGT TGCTTCGAGG ACTGAAATAT CTCCATTCAG CAGAGATACT
CCACAGAGAC CTGAAACCTG GAAATCTACT GGTTAATGCA AACTGTGATC TCAAGATATG TGATTTTGGT CTTGCACGCA
CAAACAGTAG TAAAGGTCAG TTTATGACTG AGTATGTTGT CACCCGCTGG TATAGAGCTC CTGAGTTGCT CCTTTGCTGT
GACAACTATG GCACTTCCAT TGATGTTTGG TCTGTTGGTT GCATCTTCGC TGAGCTACTT GGTCGGAAAC CTATTTTCCC
AGGAACTGAG TGCCTAAATC AGCTCAAGCT CATTGTCAAT GTTCTTGGCA CCATGAGCGA GTCTGACTTG GAGTTCATTG
ACAACCCAAA AGCTCGCAGA TATATCAAAT CCCTCCCCTA CACTCCCGGT GTGCCCCTCG CGAGTATGTA TCCGCATGCA
CACCCTCTTG CCATTGATCT TTTACAGAAG ATGCTCATAT TTGATCCTAC CAAAAGAATC AGTGTCACCG AGGCTCTTGA
GCACCCTTAC ATGTCCCCTC TGTATGATCC AAGTGCAAAT CCTCCCGCGC AAGTGCCTAT CGATCTGGAC ATAGACGAGA
ACATCAGTGC AGATATGATC AGGGAAATGA TGTGGCACGA GATGCTCCAC TACCACCCTG AAGTTGTTGC AGCAATGAGT
GCCCGATGAT CTTCAACTGT CCCCAGGAAC TTTGCAGGCT CACTTTTTTT TCTTCTTCTA AAAGCCTACG GCGATTATCG
CACCTATTAA GTAACCAAGA CGTGCAAGAC TTATTTCATG TATATATGAG CGAAATAAGA ACGTTGTTGT ATCCATATAG
TTCATGTTAT GGACCATTAC TTGGTGTATG CATTTCACAT TTCCACTGGA CAGTTATGTT GTTGTACTAG TTCATGATGA
GAAGTGCTAT TAAAGTGAAT TCAGT

Locus: Os02g0148100

Loading...

Locus: Os02g0148100

Loading...