Os02t0148500-01

Locus

Os02g0148500

Description

Similar to TIMING OF CAB 1 (Fragment).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

GATA17

CGSNL Gene Name

GATA TRANSCRIPTION FACTOR 17

Oryzabase Gene Symbol Synonym(s)

OsTIFY2a, OsCCT04, OsGATA17, OsGATA17a, OsGATA17b

Oryzabase Gene Name Synonym(s)

TIFY GENE 2A, TIFY-DOMAIN PROTEIN 2A, CCT domain-containing gene 4, CCT (CO, CO-LIKE and TOC1) domain protein 4, CCT domain protein 4, GATA transcription factor 17, GATA factor 17

Transcript Evidence

AK068931 (DDBJ, Best hit)

Protein Evidence

NP_001148559.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: sequence-specific DNA binding transcription factor activity (GO:0003700)

Molecular Function: protein binding (GO:0005515)

Molecular Function: zinc ion binding (GO:0008270)

Molecular Function: sequence-specific DNA binding (GO:0043565)

Functional domain (InterPro)

Zinc finger, GATA-type (IPR000679)

Tify (IPR010399)

CCT domain (IPR010402)

Zinc finger, NHR/GATA-type (IPR013088)

Full-length cDNA

J023003E02 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0148500-01)

RiceXPro (AK068931)

Others

Oryzabase (15741)

KEGG (Os02t0148500-01)

Transcript

1388 bp

>Os02t0148500-01 Similar to TIMING OF CAB 1 (Fragment).
AGGGTTTGGTCTCGCCTCCATCCCCATCGTCCGATCCGATCCCCCGCCATGAGCGGCCAC
CACGAAGCTAAGCCCTACCAGCCCCGCCGCGGCCCGGCTCCCGCCGACGAGGAGGCCGCC
CCCGCCGCTGCGGCGGACGAGGCGGAGGCGGAGGCGGAGGTGGAGGCTATGGAGCGGTAC
GAGCAGGAGCAGGAGTACGAGGAGGGGGAGGAGGGGGAGGAGGAGGAGTACGAGGGCGGG
GAGGGGGTCCCCATGGACGCCGACGCCTCCGCCGCGGCCGTGGCGGGGATGGACCCGCAC
GGGGAGATGGTGCCCGTGGCCGGCGGGGAGGCGGGCGGCGGCTACCCGCACGTGGCGTCG
AACACCCTCACGCTGTCGTTCCAGGGCGAGGTCTACGTCTTCGAGTCCGTTTCCGCCGAG
AGGGTGCAAGCTGTGCTGTTACTGCTTGGAGGAAGAGAGCTAGCACCAGGGTCGGGTTCG
GTACCATCATCTTCAGCGGCATACAGTAAGAAGATGAATTTTCCTCACCGGATGGCATCA
TTGATGAGGTTCCGGGAAAAGAGAAAAGAGAGAAACTTTGATAAGAAGATCCGGTATACT
GTTAGGAAGGAAGTTGCACTTAGGATGCAGCGTAATAGAGGCCAGTTTACATCATCAAAA
TCGAAGGCTGAAGAAGCAACATCCGTCATAACTAGTTCGGAAGGTTCGCCAAATTGGGGC
GCAGTTGAAGGTCGACCTCCATCAGCTGCTGAGTGCCATCATTGTGGTATTAGTGCAGCG
TCAACACCTATGATGCGCCGTGGTCCTGATGGCCCAAGAACATTGTGCAATGCATGTGGA
CTTATGTGGGCAAACAAGGGTACGATGAGAGAGGTAACAAAAGGTCCCCCTGTGCCCTTG
CAAATTGTGCCAGCTGCAACCAATGATGTTCAGAACGGAATCGTCGAGGCAACAGGTGTC
GAGCAGCACAATTCTGCAGTCGAGGAGGCAGTTTCTGCTGCAAATGGCCATGAATCGCAG
TCGGGAGTCGCGTGATGCTTGAGGGTTCAGACTTGAGAAAAAGGAGGAGGATGCGTATCA
ATCAACAATCAAGTAGTCATGGTGCTCAACAAGTTAACCGGATGTATGATATGACCGGCT
CTAGGATTCATGTGGTTCTGCAATGCCGGTCTCTCCGAGATGATATATGCTTGTGGCCGG
CTTTTTCTATGCTTGTATTTGAGTTTTATAGCTTTGCCTTTGGCAGTAGATAAATGGACG
AGTTCAGCTTGAGCGCATGTGACATATTTTGCATTTTACTCTCTTGTCAGATGTAATCGT
TGATTTACAGGTGACACTGGGCAAGCAGGCAGGTTAATTTCACAATCGCAGCATCAGTGC
ATTGTCTG

CDS

987 bp

>Os02t0148500-01 Similar to TIMING OF CAB 1 (Fragment).
ATGAGCGGCCACCACGAAGCTAAGCCCTACCAGCCCCGCCGCGGCCCGGCTCCCGCCGAC
GAGGAGGCCGCCCCCGCCGCTGCGGCGGACGAGGCGGAGGCGGAGGCGGAGGTGGAGGCT
ATGGAGCGGTACGAGCAGGAGCAGGAGTACGAGGAGGGGGAGGAGGGGGAGGAGGAGGAG
TACGAGGGCGGGGAGGGGGTCCCCATGGACGCCGACGCCTCCGCCGCGGCCGTGGCGGGG
ATGGACCCGCACGGGGAGATGGTGCCCGTGGCCGGCGGGGAGGCGGGCGGCGGCTACCCG
CACGTGGCGTCGAACACCCTCACGCTGTCGTTCCAGGGCGAGGTCTACGTCTTCGAGTCC
GTTTCCGCCGAGAGGGTGCAAGCTGTGCTGTTACTGCTTGGAGGAAGAGAGCTAGCACCA
GGGTCGGGTTCGGTACCATCATCTTCAGCGGCATACAGTAAGAAGATGAATTTTCCTCAC
CGGATGGCATCATTGATGAGGTTCCGGGAAAAGAGAAAAGAGAGAAACTTTGATAAGAAG
ATCCGGTATACTGTTAGGAAGGAAGTTGCACTTAGGATGCAGCGTAATAGAGGCCAGTTT
ACATCATCAAAATCGAAGGCTGAAGAAGCAACATCCGTCATAACTAGTTCGGAAGGTTCG
CCAAATTGGGGCGCAGTTGAAGGTCGACCTCCATCAGCTGCTGAGTGCCATCATTGTGGT
ATTAGTGCAGCGTCAACACCTATGATGCGCCGTGGTCCTGATGGCCCAAGAACATTGTGC
AATGCATGTGGACTTATGTGGGCAAACAAGGGTACGATGAGAGAGGTAACAAAAGGTCCC
CCTGTGCCCTTGCAAATTGTGCCAGCTGCAACCAATGATGTTCAGAACGGAATCGTCGAG
GCAACAGGTGTCGAGCAGCACAATTCTGCAGTCGAGGAGGCAGTTTCTGCTGCAAATGGC
CATGAATCGCAGTCGGGAGTCGCGTGA

Protein

329 aa

>Os02t0148500-01 Similar to TIMING OF CAB 1 (Fragment).
MSGHHEAKPYQPRRGPAPADEEAAPAAAADEAEAEAEVEAMERYEQEQEYEEGEEGEEEE
YEGGEGVPMDADASAAAVAGMDPHGEMVPVAGGEAGGGYPHVASNTLTLSFQGEVYVFES
VSAERVQAVLLLLGGRELAPGSGSVPSSSAAYSKKMNFPHRMASLMRFREKRKERNFDKK
IRYTVRKEVALRMQRNRGQFTSSKSKAEEATSVITSSEGSPNWGAVEGRPPSAAECHHCG
ISAASTPMMRRGPDGPRTLCNACGLMWANKGTMREVTKGPPVPLQIVPAATNDVQNGIVE
ATGVEQHNSAVEEAVSAANGHESQSGVA*

5'UTR

chr02:2664442..2664489 (+ strand) : 48 bp

CDS

chr02:2664490..2664864 (+ strand) : 375 bp

chr02:2664975..2665061 (+ strand) : 87 bp

chr02:2665157..2665269 (+ strand) : 113 bp

chr02:2665508..2665636 (+ strand) : 129 bp

chr02:2666690..2666795 (+ strand) : 106 bp

chr02:2667298..2667369 (+ strand) : 72 bp

chr02:2667704..2667808 (+ strand) : 105 bp

3'UTR

chr02:2667809..2668161 (+ strand) : 353 bp

FASTA

>Os02t0148500-01 class=Sequence position=chr02:2664442..2668161 (+ strand)
AGGGTTTGGT CTCGCCTCCA TCCCCATCGT CCGATCCGAT CCCCCGCCAT GAGCGGCCAC CACGAAGCTA AGCCCTACCA
GCCCCGCCGC GGCCCGGCTC CCGCCGACGA GGAGGCCGCC CCCGCCGCTG CGGCGGACGA GGCGGAGGCG GAGGCGGAGG
TGGAGGCTAT GGAGCGGTAC GAGCAGGAGC AGGAGTACGA GGAGGGGGAG GAGGGGGAGG AGGAGGAGTA CGAGGGCGGG
GAGGGGGTCC CCATGGACGC CGACGCCTCC GCCGCGGCCG TGGCGGGGAT GGACCCGCAC GGGGAGATGG TGCCCGTGGC
CGGCGGGGAG GCGGGCGGCG GCTACCCGCA CGTGGCGTCG AACACCCTCA CGCTGTCGTT CCAGGGCGAG GTCTACGTCT
TCGAGTCCGT TTCCGCCGAG AGGGTGCTGT GCCTGCGCCG CTCATCCATG ATTTCAGTTT TTTTTTGTGT GTGTTTTGCG
CACCTGAATT GCTCGGTGAA TCGGTGATGA GTTTGAATTA CTTGTGTTGG CAGGTGCAAG CTGTGCTGTT ACTGCTTGGA
GGAAGAGAGC TAGCACCAGG GTCGGGTTCG GTACCATCAT CTTCAGCGGC ATACAGTAAG GTGAAGTCAT CGCTGGGCGA
ATTATGGTGA TTGCCAGTTG AGACTATTTT AAATTGTAAT GGTGCTTATG TGACTGTGTG TACTCTCTTA TGCAGAAGAT
GAATTTTCCT CACCGGATGG CATCATTGAT GAGGTTCCGG GAAAAGAGAA AAGAGAGAAA CTTTGATAAG AAGATCCGGT
ATACTGTTAG GAAGGAAGTT GCACTTAGGT TAGTTAGACT AGCCTTTTAA TATAGCCTTC TTTTCCCTGT CTATATTCTA
GAGTATTTGT TATGTTGTGT ATTTAGTGTT AGCTTATTAA TATAATCCAT TTTCTCTGTT TAATATTATG AAGTTTTCTT
ATGGTGGATG AACTTGTTAT TGCATTTGAT TTTGTATATT TGGCAATGTG AATTTTCCTT TTTAAGTTTT ATGAGATAGT
AGTAATTATT TTCTATACAT TTACAGGATG CAGCGTAATA GAGGCCAGTT TACATCATCA AAATCGAAGG CTGAAGAAGC
AACATCCGTC ATAACTAGTT CGGAAGGTTC GCCAAATTGG GGCGCAGTTG AAGGTCGACC TCCATCAGCT GCTGAGTATG
TATTCAAACT ATTGTACTTA TTATATCTTT ATATGTTCAT ACTTCCCATT AGTATTATAT AAATGCATGA AAATCATTAC
AACCATATTT ATATGAGGGA TGGCCATTTC TTTATGTAGT AAATAAGTGT GCCATTCATG GATCCTGATT TCCCACCTGG
GCAACTGAAT TGTGTTGTTT CGAAAATTCA TCCATAATTG GGAAATATAT TCAATATGCT CCAATTATAA GAAAATCAGT
TTCCATTGCA ACACATGGGT GCACTGCTAG GTATATCTTT GACCTAGTAA GGATGCATTA TCTCATGCTC GCACTGTCCA
CAGGGACATT GGGCTATCAT ACAGAGACTT TGTCGTTTTC TCTCAGTCAC CAACCCAACC TCCACCATGT GCCATGCAGC
ATGCACGCAC GTCGCTGGAG CTAGCTAGCT AGCCATTTTT TAATTGAACA CTTCTGGGTA GTGAGAACTG TGAAGCCTTG
AATCAAGCCT TTAACTCAGT TTGATATTTG AAAATTTACA GCACAACTAT CCTGCATATA TTTCAATTGT AGTTGGGTGC
AAAAAATAAA TCAAAATGCA TGGGAAACCT CCAGCGGAAA ATGGATCAAT GTATACATCT TTCTAGTTCC TGATAAAAAA
AATGTAGCAT CAATTTCTGT ACCAGGCAAG GTAGAAGCAC GTGATTCTAA ATCTTGACTA TTCAAGGTGT TTGCCATGTG
GCGAATGTGA CACTGCACTT TCGTACTGTA GAAGGTCATG CAGCATAAAA TTAAAAATTT CGAAATGAGA ATTGTCTGAC
TTGCATCATT CACTGCTTAC CAGATCTAGC TCTTCCATTT CAGACAGGTT TTTGCTATTT GGCTGTTGAT AACTAAAAAA
TGATAGTTGG TCTTGATCAA TTGTTTGCCA CCCACATGAT AATAGATGCC TCTTGCCTCT TGCACCTGTT GCTTGTATAT
TTGCCTTATA TTTTCTAGCT TCTTTTGCTT CAGAATTTGA AACTTAGTTC TTGTTGTGAG AGTTACTTTC CATGCACAAT
TCTTTCAGGT GCCATCATTG TGGTATTAGT GCAGCGTCAA CACCTATGAT GCGCCGTGGT CCTGATGGCC CAAGAACATT
GTGCAATGCA TGTGGACTTA TGTGGGCAAA CAAGGTACTT CCAATCTTTA TTGCACTGCA CCAGTATCTT TCTATACATT
GGTGCTAATT GCAACTTCTA GAATAGGCTG TATGTTGTTT GCATAACCTT TGTTGCATCG AGGGTGTCTC CTTCAATATT
AATATAATGA ACAATTTTTG CCTTTCTAGA GCCCAGGTAC TGTAAAATTT CCCCTTTTAC CATATGCTAA GTTTGGTGGT
AAAAGTTATA CTGTTCTAGC TTGATTGTTG TAGCTCTCAG GGTGGATCTT TTGTGTGATC TGTTGAGTGT CCAATGCATC
CCAAATCACA GTTCACATGT ATGGTCCCAT CGTGAAAGTT GGAACACCAG TAAACAGTCA TGGAAATTGT AACGTCCCCA
CCCAAAACCT CCATTACCCC AGTGGTTCAG TGTTGGTTTT AAGTTCTTAG CTTGCAGACA AGTTGCATTT AGCGTTTTTA
GGGTCAGTCT TGGTGTTATT GACAATATTC TGCTCCAATT TGTTCGTATT TCGTAGGGTA CGATGAGAGA GGTAACAAAA
GGTCCCCCTG TGCCCTTGCA AATTGTGCCA GCTGCAACCA ATGATGTTGT AAGTCACTAT GTTTGCACTT CATTCATTCA
GAATTTTAGA TTGCAAATTT TATTTATAGA TTTACCCCTC ATCCTTTTCT AACTCAAATT TAGCGTTGTG TAAAACCATT
GTTTGGGCCT GATGAAATTG GCATTAGAGT GTAAGACATA TGGACTGATG AAATGCATCC TTAGGGTGCA CTTGTTCTTT
CTTTATAGGA TGAGGATTTG TGACTTGTGA GCACGAAACA ATCATGTATT GCAGTTTCTA GAAAAAATAA CTGTTCTAGA
GCAGTGAATT TTAAACTGGG TCAGTAGTCT TACTCAAAAT GTGAATTACC CGTGTTTTTC AGCAGAACGG AATCGTCGAG
GCAACAGGTG TCGAGCAGCA CAATTCTGCA GTCGAGGAGG CAGTTTCTGC TGCAAATGGC CATGAATCGC AGTCGGGAGT
CGCGTGATGC TTGAGGGTTC AGACTTGAGA AAAAGGAGGA GGATGCGTAT CAATCAACAA TCAAGTAGTC ATGGTGCTCA
ACAAGTTAAC CGGATGTATG ATATGACCGG CTCTAGGATT CATGTGGTTC TGCAATGCCG GTCTCTCCGA GATGATATAT
GCTTGTGGCC GGCTTTTTCT ATGCTTGTAT TTGAGTTTTA TAGCTTTGCC TTTGGCAGTA GATAAATGGA CGAGTTCAGC
TTGAGCGCAT GTGACATATT TTGCATTTTA CTCTCTTGTC AGATGTAATC GTTGATTTAC AGGTGACACT GGGCAAGCAG
GCAGGTTAAT TTCACAATCG CAGCATCAGT GCATTGTCTG 

Locus: Os02g0148500

Loading...

Locus: Os02g0148500

Loading...