Os02t0167300-01

Locus

Os02g0167300

Description

Tubulin beta-3 chain (Beta-3 tubulin).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

TUB5

CGSNL Gene Name

BETA-TUBULIN 5

Oryzabase Gene Symbol Synonym(s)

OsTUB5, TUBB5, OSTB-50, R2242

Oryzabase Gene Name Synonym(s)

beta tubulin 5, Tubulin beta-5 chain, Beta-5-tubulin

Transcript Evidence

AK121574 (DDBJ, Best hit)

Protein Evidence

P46265 (UniProt)

Literature

Note

  • Exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: GTP catabolic process (GO:0006184)

Biological Process: microtubule-based process (GO:0007017)

Biological Process: microtubule-based movement (GO:0007018)

Biological Process: protein polymerization (GO:0051258)

Cellular Component: microtubule (GO:0005874)

Cellular Component: protein complex (GO:0043234)

Molecular Function: GTPase activity (GO:0003924)

Molecular Function: structural molecule activity (GO:0005198)

Molecular Function: GTP binding (GO:0005525)

Functional domain (InterPro)

Tubulin (IPR000217)

Beta tubulin (IPR002453)

Tubulin/FtsZ, GTPase domain (IPR003008)

Tubulin/FtsZ, C-terminal (IPR008280)

Beta tubulin, autoregulation binding site (IPR013838)

Tubulin, conserved site (IPR017975)

Tubulin/FtsZ, 2-layer sandwich domain (IPR018316)

Tubulin, C-terminal (IPR023123)

Full-length cDNA

J033036C16 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0167300-01)

Others

Oryzabase (2960)

Transcript

1808 bp

>Os02t0167300-01 Tubulin beta-3 chain (Beta-3 tubulin).
GCTTCCCACCCCCCAAATCCTCCTCCCTCCCTCCCCTAAACCTCGCCGGAATCCAACCCC
TCCGCCGCCGCCATGAGGGAGATCCTGCACATCCAGGGGGGGCAATGCGGGAACCAGATC
GGGGCCAAGTTCTGGGAGGTGATCTGCGACGAGCACGGGATCGACCACACCGGCAAGTAC
TCGGGCGACTCCGACCTCCAGCTCGAGCGGATCAACGTCTACTACAACGAGGCCAGCGGC
GGCAGGTTCGTTCCGCGCGCCGTGCTCATGGACCTCGAGCCGGGCACCATGGACTCGGTG
CGCTCCGGTCCCTTCGGCCAGATCTTCCGCCCCGACAACTTCGTCTTCGGCCAGTCCGGC
GCCGGCAACAACTGGGCCAAGGGGCACTACACCGAGGGCGCCGAGCTCATCGACTCCGTC
CTCGACGTCGTCCGCAAGGAGGCCGAGAACTGCGACTGCCTCCAAGGATTTCAAGTCTGC
CACTCTCTAGGAGGAGGAACTGGTTCTGGTATGGGTACCCTGCTCATCTCAAAGATCAGG
GAGGAGTACCCGGACAGGATGATGTTGACATTCTCAGTTTTCCCCTCACCAAAGGTTTCT
GATACCGTGGTGGAACCTTACAATGCCACACTATCTGTCCATCAGCTTGTTGAGAATGCC
GATGAGTGCATGGTACTTGACAATGAAGCTCTATATGACATCTGCTTCCGCACTCTGAAG
CTCGCCACACCCACTTttggtgatctgaaccatcttatttctgcaaccatgagtggtgtt
acatgctgcctgcgcttcccgggacagctgaactctgacctccgcaagctggcggttaac
ttgatccccttccctcgtctccatttcttcatggtcggctttgcaccgctgacctcgagg
ggatcccagcagtaccgcgccctcactgtcccggagctgacccagcagatgtgggacgcc
aagaacatgatgtgcgccgccgaccccaggcacggacgctacctcacggcgtcagccatg
ttccgcgggaagatgagcaccaaggaggtggacgagcagatgctcaacgtccagaacaag
aaCTCGTCCTACTTCGTGGAGTGGATCCCGAATAACGTGAAGTCGAGCGTGTGCGACATC
CCTCCCAACGGCCTGAAGATGGCGTCCACCTTCATCGGCAACTCGACGTCGATCCAGGAG
ATGTTCCGCCGCGTGAGCGAGCAGTTCACGGCCATGTTCAGGAGGAAGGCCTTCTTGCAC
TGGTACACCGGGGAGGGGATGGACGAGATGGAGTTCACCGAGGCCGAGAGCAACATGAAC
GACCTGGTGGCCGAGTACCAGCAGTACCAGGACGCGACAGCCGACGACGAGGAAGAGGAC
TACGGCGACGAGGAGGAAGACGAGGTTGCTGCCTAAGCCACCTACCTGCCTGCCATTCCT
CTCGCTCTCGTCATCCATCGTAGATGATGATTGAGGATGTGCTCCCTTGTGTTATTATTA
CCTAGTACTGTATTGCAACTGTCGATCTGGGTCGTAAGATGTTTATTTTAGGTGATTTGA
TGCTCTAGTTACTCTTTTTTTTCCTTGTGTTGATTAATGGTGTGTTGTCGATGCGAATTG
TGATACTAGCTTTAACTGTGGACTTAAATTACTAGATCCTGGAATTGATACTGTTTGCCA
GTAATATCGTGTGTTGCGTGATCATTATTTTTTCCACTACGAATACACTGCGATGTCATT
AGTGGGCGTGTGCTAGGATGTAAACGTGGATGCAGTTGTTCTAAGCCTCCGTGGTTTGCT
TGTTATCT

CDS

1344 bp

>Os02t0167300-01 Tubulin beta-3 chain (Beta-3 tubulin).
ATGAGGGAGATCCTGCACATCCAGGGGGGGCAATGCGGGAACCAGATCGGGGCCAAGTTC
TGGGAGGTGATCTGCGACGAGCACGGGATCGACCACACCGGCAAGTACTCGGGCGACTCC
GACCTCCAGCTCGAGCGGATCAACGTCTACTACAACGAGGCCAGCGGCGGCAGGTTCGTT
CCGCGCGCCGTGCTCATGGACCTCGAGCCGGGCACCATGGACTCGGTGCGCTCCGGTCCC
TTCGGCCAGATCTTCCGCCCCGACAACTTCGTCTTCGGCCAGTCCGGCGCCGGCAACAAC
TGGGCCAAGGGGCACTACACCGAGGGCGCCGAGCTCATCGACTCCGTCCTCGACGTCGTC
CGCAAGGAGGCCGAGAACTGCGACTGCCTCCAAGGATTTCAAGTCTGCCACTCTCTAGGA
GGAGGAACTGGTTCTGGTATGGGTACCCTGCTCATCTCAAAGATCAGGGAGGAGTACCCG
GACAGGATGATGTTGACATTCTCAGTTTTCCCCTCACCAAAGGTTTCTGATACCGTGGTG
GAACCTTACAATGCCACACTATCTGTCCATCAGCTTGTTGAGAATGCCGATGAGTGCATG
GTACTTGACAATGAAGCTCTATATGACATCTGCTTCCGCACTCTGAAGCTCGCCACACCC
ACTTttggtgatctgaaccatcttatttctgcaaccatgagtggtgttacatgctgcctg
cgcttcccgggacagctgaactctgacctccgcaagctggcggttaacttgatccccttc
cctcgtctccatttcttcatggtcggctttgcaccgctgacctcgaggggatcccagcag
taccgcgccctcactgtcccggagctgacccagcagatgtgggacgccaagaacatgatg
tgcgccgccgaccccaggcacggacgctacctcacggcgtcagccatgttccgcgggaag
atgagcaccaaggaggtggacgagcagatgctcaacgtccagaacaagaaCTCGTCCTAC
TTCGTGGAGTGGATCCCGAATAACGTGAAGTCGAGCGTGTGCGACATCCCTCCCAACGGC
CTGAAGATGGCGTCCACCTTCATCGGCAACTCGACGTCGATCCAGGAGATGTTCCGCCGC
GTGAGCGAGCAGTTCACGGCCATGTTCAGGAGGAAGGCCTTCTTGCACTGGTACACCGGG
GAGGGGATGGACGAGATGGAGTTCACCGAGGCCGAGAGCAACATGAACGACCTGGTGGCC
GAGTACCAGCAGTACCAGGACGCGACAGCCGACGACGAGGAAGAGGACTACGGCGACGAG
GAGGAAGACGAGGTTGCTGCCTAA

Protein

448 aa

>Os02t0167300-01 Tubulin beta-3 chain (Beta-3 tubulin).
MREILHIQGGQCGNQIGAKFWEVICDEHGIDHTGKYSGDSDLQLERINVYYNEASGGRFV
PRAVLMDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
RKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLTFSVFPSPKVSDTVV
EPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLNHLISATMSGVTCCL
RFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTVPELTQQMWDAKNMM
CAADPRHGRYLTASAMFRGKMSTKEVDEQMLNVQNKNSSYFVEWIPNNVKSSVCDIPPNG
LKMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVA
EYQQYQDATADDEEEDYGDEEEDEVAA*

5'UTR

chr02:3619840..3619911 (+ strand) : 72 bp

CDS

chr02:3619912..3620305 (+ strand) : 394 bp

chr02:3621126..3621395 (+ strand) : 270 bp

chr02:3621791..3622470 (+ strand) : 680 bp

3'UTR

chr02:3622471..3622862 (+ strand) : 392 bp

FASTA

>Os02t0167300-01 class=Sequence position=chr02:3619840..3622862 (+ strand)
GCTTCCCACC CCCCAAATCC TCCTCCCTCC CTCCCCTAAA CCTCGCCGGA ATCCAACCCC TCCGCCGCCG CCATGAGGGA
GATCCTGCAC ATCCAGGGGG GGCAATGCGG GAACCAGATC GGGGCCAAGT TCTGGGAGGT GATCTGCGAC GAGCACGGGA
TCGACCACAC CGGCAAGTAC TCGGGCGACT CCGACCTCCA GCTCGAGCGG ATCAACGTCT ACTACAACGA GGCCAGCGGC
GGCAGGTTCG TTCCGCGCGC CGTGCTCATG GACCTCGAGC CGGGCACCAT GGACTCGGTG CGCTCCGGTC CCTTCGGCCA
GATCTTCCGC CCCGACAACT TCGTCTTCGG CCAGTCCGGC GCCGGCAACA ACTGGGCCAA GGGGCACTAC ACCGAGGGCG
CCGAGCTCAT CGACTCCGTC CTCGACGTCG TCCGCAAGGA GGCCGAGAAC TGCGACTGCC TCCAAGGTAT TTTGCTAGAT
CTGCTCGTTT TGTTTGGAAT GGTGGGAGAT TGGGTGTTGC TTTGCTGCAT TCCGCGTGTA GATCTTGTGT TCCATGCTTG
TCGTAGCGCG AATGGTGGGG GAATGCTGCG ATTCTAGGGT TCTTAGCTCG TAGATCTGGC CATTTTTTTT TACTGAACAT
GTAGATCTGT GTGTTTCACT GCGCAATCCA TTCGTGGTGT AGTTGGGGAG GAGATGTTCC AACTGCTGAG ATGTGGTGAT
TAGCACAGTA GGTGTGGTGG TTGTCAACAA CCTTGTTAAG CCTTTCCTCG TGTAGTACTT AAGATGTGGT AGATCCGGCA
CAATTTCATT TATCATTGTA TGCTTGATTG GTTGGTTTGT TGCCTTGCTT AGCTGCAAAT GTGGAACTCT ACATTCCCCT
GACTTGTAGT AAACTGTAAT TTTTCGCGAG TTGTTGAAGG CATTTTAATT CGAACTGACA CTTTTACACT TGCAAGTGTA
ACTGCAAGCT ACTAAAATGG TAGTAGAATC TAGGGGCTGT AATTCAAGTT TTACCTTTGA GCCCAGCTTA TCTTAAGGTT
GTTTCTGGTG CAATACTCTG ATATTTGCTA GAATGATAGA TGCAGTTAGG AAAATAATGC AGCATATTGT TGTTTAGTTC
TACTGAATAG GTATGCTATG TGGTTTCTGT CACATTCACA CATCAGTAGT TCACTTGGTG GTGCCTTAAG TGAAGCGCTT
ATGATTCACG CTGATGTGTT GCAGTTTGTG TTCAACATCA ACTGAATATT GGGTAGGAAT TAATGTATGT GCTCCATTTG
CCACAGGATT TCAAGTCTGC CACTCTCTAG GAGGAGGAAC TGGTTCTGGT ATGGGTACCC TGCTCATCTC AAAGATCAGG
GAGGAGTACC CGGACAGGAT GATGTTGACA TTCTCAGTTT TCCCCTCACC AAAGGTTTCT GATACCGTGG TGGAACCTTA
CAATGCCACA CTATCTGTCC ATCAGCTTGT TGAGAATGCC GATGAGTGCA TGGTACTTGA CAATGAAGCT CTATATGACA
TCTGCTTCCG CACTCTGAAG CTCGCCACAC CCACTTGTAA GTGAAAACAT GCCATAATTA TGGTACTGTG CTCAGTTATC
GTACTCTGCT CTATGTTGTT ATTGATCATT GATTTCATCC TGGTACATCA GAGCAGTTTA TAATCAGTCA CCTTTATGTC
AGATGCCACT ACCAATTTAC TCTTTTGTGA AGTACGGAGT ATAATGAATT AGCTGGTCCA TGTTCCCCAT TGTTGTGTGT
TTCATGCATC CTGGCACTAC TTGATTCAAT TAATGAGTAT GTCTGGAACT TGCATTCGAA TACACTGATA CTGAATATAT
AGATGATAAG TCTGTACTAC ATGTATGGGG TCTACAGTGT TGATATGAAT ATGGGTTTCT TCATGCTGTT TTACCTAATT
CTGACTCTGC TTTGTTTCTT TCCTTTTGCA Gttggtgatc tgaaccatct tatttctgca accatgagtg gtgttacatg
ctgcctgcgc ttcccgggac agctgaactc tgacctccgc aagctggcgg ttaacttgat ccccttccct cgtctccatt
tcttcatggt cggctttgca ccgctgacct cgaggggatc ccagcagtac cgcgccctca ctgtcccgga gctgacccag
cagatgtggg acgccaagaa catgatgtgc gccgccgacc ccaggcacgg acgctacctc acggcgtcag ccatgttccg
cgggaagatg agcaccaagg aggtggacga gcagatgctc aacgtccaga acaagaaCTC GTCCTACTTC GTGGAGTGGA
TCCCGAATAA CGTGAAGTCG AGCGTGTGCG ACATCCCTCC CAACGGCCTG AAGATGGCGT CCACCTTCAT CGGCAACTCG
ACGTCGATCC AGGAGATGTT CCGCCGCGTG AGCGAGCAGT TCACGGCCAT GTTCAGGAGG AAGGCCTTCT TGCACTGGTA
CACCGGGGAG GGGATGGACG AGATGGAGTT CACCGAGGCC GAGAGCAACA TGAACGACCT GGTGGCCGAG TACCAGCAGT
ACCAGGACGC GACAGCCGAC GACGAGGAAG AGGACTACGG CGACGAGGAG GAAGACGAGG TTGCTGCCTA AGCCACCTAC
CTGCCTGCCA TTCCTCTCGC TCTCGTCATC CATCGTAGAT GATGATTGAG GATGTGCTCC CTTGTGTTAT TATTACCTAG
TACTGTATTG CAACTGTCGA TCTGGGTCGT AAGATGTTTA TTTTAGGTGA TTTGATGCTC TAGTTACTCT TTTTTTTCCT
TGTGTTGATT AATGGTGTGT TGTCGATGCG AATTGTGATA CTAGCTTTAA CTGTGGACTT AAATTACTAG ATCCTGGAAT
TGATACTGTT TGCCAGTAAT ATCGTGTGTT GCGTGATCAT TATTTTTTCC ACTACGAATA CACTGCGATG TCATTAGTGG
GCGTGTGCTA GGATGTAAAC GTGGATGCAG TTGTTCTAAG CCTCCGTGGT TTGCTTGTTA TCT

Locus: Os02g0167300

Loading...

Locus: Os02g0167300

Loading...