Os02t0167300-02

Locus

Os02g0167300

Description

Similar to Tubulin beta-5 chain.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

TUB5

CGSNL Gene Name

BETA-TUBULIN 5

Oryzabase Gene Symbol Synonym(s)

OsTUB5, TUBB5, OSTB-50, R2242

Oryzabase Gene Name Synonym(s)

beta tubulin 5, Tubulin beta-5 chain, Beta-5-tubulin

Transcript Evidence

AK061659 (DDBJ, Best hit)

AK119164 (DDBJ, Best hit)

Protein Evidence

P46265 (UniProt)

Literature

Note

  • Exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: GTP catabolic process (GO:0006184)

Biological Process: microtubule-based process (GO:0007017)

Biological Process: microtubule-based movement (GO:0007018)

Biological Process: protein polymerization (GO:0051258)

Cellular Component: microtubule (GO:0005874)

Cellular Component: protein complex (GO:0043234)

Molecular Function: GTPase activity (GO:0003924)

Molecular Function: structural molecule activity (GO:0005198)

Molecular Function: GTP binding (GO:0005525)

Functional domain (InterPro)

Tubulin (IPR000217)

Beta tubulin (IPR002453)

Tubulin/FtsZ, GTPase domain (IPR003008)

Tubulin/FtsZ, C-terminal (IPR008280)

Tubulin/FtsZ, 2-layer sandwich domain (IPR018316)

Tubulin, C-terminal (IPR023123)

Full-length cDNA

001-036-D12 (Online Clone Ordering)

001-036-E05 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0167300-02)

Others

Oryzabase (2960)

Transcript

1235 bp

>Os02t0167300-02 Similar to Tubulin beta-5 chain.
CTGGTATGGGTACCCTGCTCATCTCAAAGATCAGGGAGGAGTACCCGGACAGGATGATGT
TGACATTCTCAGTTTTCCCCTCACCAAAGGTTTCTGATACCGTGGTGGAACCTTACAATG
CCACACTATCTGTCCATCAGCTTGTTGAGAATGCCGATGAGTGCATGGTACTTGACAATG
AAGCTCTATATGACATCTGCTTCCGCACTCTGAAGCTCGCCACACCCACTTttggtgatc
tgaaccatcttatttctgcaaccatgagtggtgttacatgctgcctgcgcttcccgggac
agctgaactctgacctccgcaagctggcggttaacttgatccccttccctcgtctccatt
tcttcatggtcggctttgcaccgctgacctcgaggggatcccagcagtaccgcgccctca
ctgtcccggagctgacccagcagatgtgggacgccaagaacatgatgtgcgccgccgacc
ccaggcacggacgctacctcacggcgtcagccatgttccgcgggaagatgagcaccaagg
aggtggacgagcagatgctcaacgtccagaacaagaaCTCGTCCTACTTCGTGGAGTGGA
TCCCGAATAACGTGAAGTCGAGCGTGTGCGACATCCCTCCCAACGGCCTGAAGATGGCGT
CCACCTTCATCGGCAACTCGACGTCGATCCAGGAGATGTTCCGCCGCGTGAGCGAGCAGT
TCACGGCCATGTTCAGGAGGAAGGCCTTCTTGCACTGGTACACCGGGGAGGGGATGGACG
AGATGGAGTTCACCGAGGCCGAGAGCAACATGAACGACCTGGTGGCCGAGTACCAGCAGT
ACCAGGACGCGACAGCCGACGACGAGGAAGAGGACTACGGCGACGAGGAGGAAGACGAGG
TTGCTGCCTAAGCCACCTACCTGCCTGCCATTCCTCTCGCTCTCGTCATCCATCGTAGAT
GATGATTGAGGATGTGCTCCCTTGTGTTATTATTACCTAGTACTGTATTGCAACTGTCGA
TCTGGGTCGTAAGATGTTTATTTTAGGTGATTTGATGCTCTAGTTACTCTTTTTTTTCCT
TGTGTTGATTAATGGTGTGTTGTCGATGCGAATTGTGATACTAGCTTTAACTGTGGACTT
AAATTACTAGATCCTGGAATTGATACTGTTTGCCAGTAATATCGTGTGTTGCGTGATCAT
TATTTTTTCCACTACGAATACACTGCGATGTCATT

CDS

909 bp

>Os02t0167300-02 Similar to Tubulin beta-5 chain.
GGTATGGGTACCCTGCTCATCTCAAAGATCAGGGAGGAGTACCCGGACAGGATGATGTTG
ACATTCTCAGTTTTCCCCTCACCAAAGGTTTCTGATACCGTGGTGGAACCTTACAATGCC
ACACTATCTGTCCATCAGCTTGTTGAGAATGCCGATGAGTGCATGGTACTTGACAATGAA
GCTCTATATGACATCTGCTTCCGCACTCTGAAGCTCGCCACACCCACTTttggtgatctg
aaccatcttatttctgcaaccatgagtggtgttacatgctgcctgcgcttcccgggacag
ctgaactctgacctccgcaagctggcggttaacttgatccccttccctcgtctccatttc
ttcatggtcggctttgcaccgctgacctcgaggggatcccagcagtaccgcgccctcact
gtcccggagctgacccagcagatgtgggacgccaagaacatgatgtgcgccgccgacccc
aggcacggacgctacctcacggcgtcagccatgttccgcgggaagatgagcaccaaggag
gtggacgagcagatgctcaacgtccagaacaagaaCTCGTCCTACTTCGTGGAGTGGATC
CCGAATAACGTGAAGTCGAGCGTGTGCGACATCCCTCCCAACGGCCTGAAGATGGCGTCC
ACCTTCATCGGCAACTCGACGTCGATCCAGGAGATGTTCCGCCGCGTGAGCGAGCAGTTC
ACGGCCATGTTCAGGAGGAAGGCCTTCTTGCACTGGTACACCGGGGAGGGGATGGACGAG
ATGGAGTTCACCGAGGCCGAGAGCAACATGAACGACCTGGTGGCCGAGTACCAGCAGTAC
CAGGACGCGACAGCCGACGACGAGGAAGAGGACTACGGCGACGAGGAGGAAGACGAGGTT
GCTGCCTAA

Protein

303 aa

>Os02t0167300-02 Similar to Tubulin beta-5 chain.
GMGTLLISKIREEYPDRMMLTFSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNE
ALYDICFRTLKLATPTFGDLNHLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHF
FMVGFAPLTSRGSQQYRALTVPELTQQMWDAKNMMCAADPRHGRYLTASAMFRGKMSTKE
VDEQMLNVQNKNSSYFVEWIPNNVKSSVCDIPPNGLKMASTFIGNSTSIQEMFRRVSEQF
TAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVAEYQQYQDATADDEEEDYGDEEEDEV
AA*

5'UTR

chr02:3621165..3621166 (+ strand) : 2 bp

CDS

chr02:3621167..3621395 (+ strand) : 229 bp

chr02:3621791..3622470 (+ strand) : 680 bp

3'UTR

chr02:3622471..3622794 (+ strand) : 324 bp

FASTA

>Os02t0167300-02 class=Sequence position=chr02:3621165..3622794 (+ strand)
CTGGTATGGG TACCCTGCTC ATCTCAAAGA TCAGGGAGGA GTACCCGGAC AGGATGATGT TGACATTCTC AGTTTTCCCC
TCACCAAAGG TTTCTGATAC CGTGGTGGAA CCTTACAATG CCACACTATC TGTCCATCAG CTTGTTGAGA ATGCCGATGA
GTGCATGGTA CTTGACAATG AAGCTCTATA TGACATCTGC TTCCGCACTC TGAAGCTCGC CACACCCACT TGTAAGTGAA
AACATGCCAT AATTATGGTA CTGTGCTCAG TTATCGTACT CTGCTCTATG TTGTTATTGA TCATTGATTT CATCCTGGTA
CATCAGAGCA GTTTATAATC AGTCACCTTT ATGTCAGATG CCACTACCAA TTTACTCTTT TGTGAAGTAC GGAGTATAAT
GAATTAGCTG GTCCATGTTC CCCATTGTTG TGTGTTTCAT GCATCCTGGC ACTACTTGAT TCAATTAATG AGTATGTCTG
GAACTTGCAT TCGAATACAC TGATACTGAA TATATAGATG ATAAGTCTGT ACTACATGTA TGGGGTCTAC AGTGTTGATA
TGAATATGGG TTTCTTCATG CTGTTTTACC TAATTCTGAC TCTGCTTTGT TTCTTTCCTT TTGCAGttgg tgatctgaac
catcttattt ctgcaaccat gagtggtgtt acatgctgcc tgcgcttccc gggacagctg aactctgacc tccgcaagct
ggcggttaac ttgatcccct tccctcgtct ccatttcttc atggtcggct ttgcaccgct gacctcgagg ggatcccagc
agtaccgcgc cctcactgtc ccggagctga cccagcagat gtgggacgcc aagaacatga tgtgcgccgc cgaccccagg
cacggacgct acctcacggc gtcagccatg ttccgcggga agatgagcac caaggaggtg gacgagcaga tgctcaacgt
ccagaacaag aaCTCGTCCT ACTTCGTGGA GTGGATCCCG AATAACGTGA AGTCGAGCGT GTGCGACATC CCTCCCAACG
GCCTGAAGAT GGCGTCCACC TTCATCGGCA ACTCGACGTC GATCCAGGAG ATGTTCCGCC GCGTGAGCGA GCAGTTCACG
GCCATGTTCA GGAGGAAGGC CTTCTTGCAC TGGTACACCG GGGAGGGGAT GGACGAGATG GAGTTCACCG AGGCCGAGAG
CAACATGAAC GACCTGGTGG CCGAGTACCA GCAGTACCAG GACGCGACAG CCGACGACGA GGAAGAGGAC TACGGCGACG
AGGAGGAAGA CGAGGTTGCT GCCTAAGCCA CCTACCTGCC TGCCATTCCT CTCGCTCTCG TCATCCATCG TAGATGATGA
TTGAGGATGT GCTCCCTTGT GTTATTATTA CCTAGTACTG TATTGCAACT GTCGATCTGG GTCGTAAGAT GTTTATTTTA
GGTGATTTGA TGCTCTAGTT ACTCTTTTTT TTCCTTGTGT TGATTAATGG TGTGTTGTCG ATGCGAATTG TGATACTAGC
TTTAACTGTG GACTTAAATT ACTAGATCCT GGAATTGATA CTGTTTGCCA GTAATATCGT GTGTTGCGTG ATCATTATTT
TTTCCACTAC GAATACACTG CGATGTCATT 

Locus: Os02g0167300

Loading...

Locus: Os02g0167300

Loading...