Os02t0167700-01

Locus

Os02g0167700

Description

Homolog of Arabidopsis CAND1, Auxin signaling to maintain the G2/M cell cycle transition in crown root meristem, Required for crown root emergence

RAP-DB Gene Symbol Synonym(s)

OsCAND1

RAP-DB Gene Name Synonym(s)

Cullin-associated and neddylation-dissociated 1

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK069128

Protein Evidence

Q6H4V4

Literature

PMID: 20978084

Note

Manual Curation

December 3, 2020

Functional domain (InterPro)

Armadillo-type fold (IPR016024)

TATA-binding protein interacting (TIP20) (IPR013932)

Experimentally confirmed subcellular location

nucleus (GO:0005634)

Full-length cDNA

J023003N20 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0167700-01)

RiceXPro (AK069128)

Others

KEGG (Os02t0167700-01)

Transcript

4274 bp

>Os02t0167700-01 Homolog of Arabidopsis CAND1, Auxin signaling to maintain the G2/M cell cycle transition in crown root meristem, Required for crown root emergence
AATCCCCCATCGGCGTCAGGGCCGTGACGGCAAAAAATACAGCGAGCTCTCCAAGCCCTA
GCCGCCGCCCGCCCGCCTCCCCTTCCCGACCCCTCGCCGCCGGCGAGCCGGCCGCGTGGA
GTCGCCCCCCCGCCGCGGTTCCCGCCGTCCGCTACGTTGTCTCGGGCCCCGGAGTGCTGG
GATCGCGCCGCGTGCTGGACTCACTGGACTGGACTGGAGACGCCGCCCTCCGCTCGACTA
GCCCCCACCCCCCACCGGCGTCGTCGTCGTCGTCAAGGGCTCACCATCGCTAGCAGGGCA
ACAGTGATTAGTTCCGCGGAAAAGGACTTTTGGATACGGTTTAGCTAAAATGGCAAACAT
GAACATAACCACCATCTTGGAGAAGATGACAGGGAAAGATAAGGACTACAGATATATGGC
AACTTCAGATTTGCTTAGCGAATTGAACAAAGAGGGCTTCAAAGCTGACCAAGACATCGA
GCCAAAGTTGACTACTACCGTTCTTCAACAACTGGAAGATGCTTCAGGAGATGTCTCTGG
TTTAGCTGTTAAATGCTTGGCTCCACTTGTCAAGAAGGTTGGTGAGGATAGGGTGGTGGA
GATGACCAACATTCTTTGTGATAAGTTACTCAATGGAAAGGACCAACATCGAGACACTGC
TAGTATTGCTCTGAAGACAATCATTGTGGAAGTTACGACAACATCACTTGCTGAAAAGAT
TTTGGTGTCTCTTGCCCCACAGCTAATCAAGGGCGCCACTGCTGGAAAAAGTGCGGAAGT
GAAATGCGAGTGCCTTGATATATTGGGGGATGTACTTCATAGATTTGGCAACTTGATCAC
AAAAGATCATGATAGTATGCTCACTGCCTTGTTATCCCAGTTGAGCTCTAACCAAGCAAG
TGTTAGGAAAAAGTCTATTTCTTGCATTGCATCACTTGCTGCATGTCTGTCTGATGATTT
ATTAGCCAAGGCAACTTTTGAGGTTGTCCAGTTGCTTAAAAATAGAAGTGCAAAGTCTGA
AATTGCCCGAACAAATATCCAGATGATTGGCGCTCTAAGTCGCTCGGTTGGATACCGTTT
TGGGCCACACCTTGCTGAAGCTGTTCCTTTGCTCATAAACTATTGTACAAGTGCATCGGA
AAATGATGAAGAGCTCCGTGAATACAGCTTGCAGGCCCTCGAGAGTTTTATGCTGAGGTG
TCCAAGAGATATATCTCCATATTGTGAGGGTATTTTAAATCTTGCATTGGAATATATAAG
CTATGATCCAAATTTCACTGATAGCATGGAGGAGGACACTGATGATGAGGCTCAGGATGA
GGAAGATGATGATGAGAGCGCAAATGAATACACAGATGATGAGGATGCAAGCTGGAAAGT
CCGGAGGGCTTCAGCAAAGTGCTTATCTGCAATTATAGTATCTCGTCCTGAAATGTTGTC
TAAGATGTATCTGGAGGCTTGTCCAAAGTTAATCGAACGGTTTAGGGAAAGAGAGGAAAA
TGTAAAGATGGACATCTTTAACACATTTATTGAGTTGTTACGCCAAACTGGTAACATGAC
AAAAGGACAAGGTGACATTGATGAGTCTAGCCCTAGATGGTTGCTGAAACAAGAAGTACC
TAAGGTTGTCAAATCCATCAATAGGCAGTTGCGTGAAAAATCAATCAAGACAAAGGTTGG
AGCATTCTCTGTATTGAAGGAGCTTGTTGTTGTACTGCCAGACTGTCTTGCTGATCATAT
TGGGTCACTTGTTCCTGGGATTGAGAAGGCTTTGAATGATAAGTCATCTACCTCCAACCT
GAAGATTGAAGCCCTTGTATTTACAAGACTTGTTATGGCTTCACATTCCCCAGCTGTGTT
TCATCCATACATACAGGCCCTTTCTGGCCCAATATTGTCTGCTATTGGAGACAGATATTA
CAAAGTCACCGCTGAGGCTTTAAGAGTCTGCGGAGAGCTAGTTCGTGTACTTCGTCCAAA
TTTTGAGGCACGCACTCTAGATTACAGGCCATATATTGGTCCAATCTATAAGGCTATCTT
GGCCCGCTTGGCAAATCAGGATCAGGATCAGGAAGTTAAAGAGTGTGCCATATCTTGCAT
GAGCCTTGTGGTATTCACGTTTGGTGATGGTCTCCAAAGGGAACTGCCGGCATGCCTTCC
CATTCTTGTTGATAGAATGGGTAATGAAATAACTAGACTTACAGCAGTTAAGGCGTTTGC
AGTGATTGCTAAATCACCTCTTCGCATTGATCTTTCGTGTGTCCTAGACCATGTCATTTC
TGAGCTCACGGCTTTCCTTCGAAAGGCAAACAGAGCTCTAAGGCAGGCTACATTGGGAAC
ACTAAATTCTCTTGTTGTTGCGTATGGTGGTCAAATTGGATCCTCTTATGAAACTATTAT
TGCTGAACTTTCTACGCTCATTAGTGACATGGATTTGCACATGACTGCTCTTGCGCTGGA
ACTTTGTTGCACGATCATGGTCGATAGAAAATCCATCCAAAATGTTGGTCTTGCAGTGAG
GTACAAGGTTTTGCCCCAGGCCCTTATTTTGATCAGGAGTGCTCTCTTGCAAGGGCAGGC
ACTACAGGCACTGCAGAGATTTTTTGCTTCACTGGTCCAGTCTGCAAATACAAGCTTTGA
CACTTTGTTGGATTCTCTTATTTCTACTGCTAAACCATCGCAGTCAGGTGGACTTGCCAA
ACAAGCATTGTCTTCCATTGCACAGTGTGTTGCTGTGTTGTGCTTAGCAGCTGGGGATCA
GAAGTGTGCCTCAACTATTGAAATGCTTAAAGGCATTTTAAAAGATGACAGCACTACTAA
TTCTGCTAAACAGCACATGGCCTTGTTATGTTTGGGAGAAATTGGAAGAAGGAAGGACCT
CAGCAATCATGCTCAAATTGAGAATATTGTCATTGAGTCATTTCAGTCACCTTTTGAGGA
GATCAAATCTGCAGCGTCATATGCTCTCGGAAACATTGCTGTTGGAAATTTATCGAAGTA
TTTGCCTTTTATCTTGAATCAGATTGACAACCAACAGAAGAAACAGTATCTATTGCTTCA
TTCACTGAAAGAGGTAATTGCACGGCAGTCTGTTGACCATACTGGCCAGAGTGAGCTCCA
GGATTCAAACATTGAGAAGATTTTGGCATTGCTCTTTAATCACTGTGAAAGTGAGGAGGA
AGGAGTTCGGAATGTAGTTGCAGAATGCTTAGGCAAAATTGCTCTGATTGAACCTAGGAA
ATTAATCCCTGCTCTAAAGGAACGCACATCTAGTCCTGCTGCAAACACAAGAGCTACAGT
TGCCATTGCTATAAAATATTCAATTGTTGAACGGCCTGGAAAAATAGATGAAATTATGTA
CTCCGAGATTTCTACCTTCCTGATGTTGATTAAAGACAGTGACAGGCACGTGAGGCGTGC
AGCTGTGCTGGCCTTGAGTACAGCTGCCCACAACAAGCCAAATTTGATTAAGGGTCTTCT
TCCTGAATTATTGCCTCTTTTGTATGACCAAACTGTTGTTAAGCAAGAATTGATCAGAAC
AGTTGACCTTGGGCCTTTCAAGCATGTTGTGGACGATGGTCTTGAACTCAGGAAAGCTGC
CTTTGAATGTGTGGATACATTGCTGGATAGCTGTCTTGATCAAGTGAACCCATCATCATT
TATCGTTCCTTTCCTCTTATCTGGTTTAGGTGATCATTATGATGTAAAAATGCCTTGCCA
TCTGATTCTCTCAAAGCTAGCAGACAAGTGCCCTTCTGCTGTTCTGGCAGTTTTGGACTC
ATTAGTTGACCCCATTGAGAAAACTATAAATCACAAACCCAAGGGCGATGCAGTGAAGCA
AGAGGTTGATCGCAATGAAGACATGATTCGAAGTGCTCTTCGAGCAATCGCTGCTCTAAG
CCGCATAAGTGGTAATGATTACAGCATGAGGTTCAAGAATCTGATGAACAAGATAATGGC
CTCACCTCCGCTTGCTGACAAGTACAACTCGGTGCGCAGCGAGTAAGAGCTGATCTTTTT
GTATATGGTAGAAAATAGTTGGAGCCGACTTGGTATATGTGCCACTGCCTATTCTGAGGT
GAAGATTCAACCCAGCATTGCCCTATATTTTTCTGGTGGAGCTAGTCCGAAACACTGAAC
GATACAGCTGAGACTAAGAGGTGGTTTGAAAATTTGCGAACACAAATGGCTGGTTGGAAG
CTAGACTTTTTTTTTTTGTCTTGTACAAAGTATGGCGGCAATTCACTAGATTCAGTAAAG
TTGGATTATATTTT

CDS

3657 bp

>Os02t0167700-01 Homolog of Arabidopsis CAND1, Auxin signaling to maintain the G2/M cell cycle transition in crown root meristem, Required for crown root emergence
ATGGCAAACATGAACATAACCACCATCTTGGAGAAGATGACAGGGAAAGATAAGGACTAC
AGATATATGGCAACTTCAGATTTGCTTAGCGAATTGAACAAAGAGGGCTTCAAAGCTGAC
CAAGACATCGAGCCAAAGTTGACTACTACCGTTCTTCAACAACTGGAAGATGCTTCAGGA
GATGTCTCTGGTTTAGCTGTTAAATGCTTGGCTCCACTTGTCAAGAAGGTTGGTGAGGAT
AGGGTGGTGGAGATGACCAACATTCTTTGTGATAAGTTACTCAATGGAAAGGACCAACAT
CGAGACACTGCTAGTATTGCTCTGAAGACAATCATTGTGGAAGTTACGACAACATCACTT
GCTGAAAAGATTTTGGTGTCTCTTGCCCCACAGCTAATCAAGGGCGCCACTGCTGGAAAA
AGTGCGGAAGTGAAATGCGAGTGCCTTGATATATTGGGGGATGTACTTCATAGATTTGGC
AACTTGATCACAAAAGATCATGATAGTATGCTCACTGCCTTGTTATCCCAGTTGAGCTCT
AACCAAGCAAGTGTTAGGAAAAAGTCTATTTCTTGCATTGCATCACTTGCTGCATGTCTG
TCTGATGATTTATTAGCCAAGGCAACTTTTGAGGTTGTCCAGTTGCTTAAAAATAGAAGT
GCAAAGTCTGAAATTGCCCGAACAAATATCCAGATGATTGGCGCTCTAAGTCGCTCGGTT
GGATACCGTTTTGGGCCACACCTTGCTGAAGCTGTTCCTTTGCTCATAAACTATTGTACA
AGTGCATCGGAAAATGATGAAGAGCTCCGTGAATACAGCTTGCAGGCCCTCGAGAGTTTT
ATGCTGAGGTGTCCAAGAGATATATCTCCATATTGTGAGGGTATTTTAAATCTTGCATTG
GAATATATAAGCTATGATCCAAATTTCACTGATAGCATGGAGGAGGACACTGATGATGAG
GCTCAGGATGAGGAAGATGATGATGAGAGCGCAAATGAATACACAGATGATGAGGATGCA
AGCTGGAAAGTCCGGAGGGCTTCAGCAAAGTGCTTATCTGCAATTATAGTATCTCGTCCT
GAAATGTTGTCTAAGATGTATCTGGAGGCTTGTCCAAAGTTAATCGAACGGTTTAGGGAA
AGAGAGGAAAATGTAAAGATGGACATCTTTAACACATTTATTGAGTTGTTACGCCAAACT
GGTAACATGACAAAAGGACAAGGTGACATTGATGAGTCTAGCCCTAGATGGTTGCTGAAA
CAAGAAGTACCTAAGGTTGTCAAATCCATCAATAGGCAGTTGCGTGAAAAATCAATCAAG
ACAAAGGTTGGAGCATTCTCTGTATTGAAGGAGCTTGTTGTTGTACTGCCAGACTGTCTT
GCTGATCATATTGGGTCACTTGTTCCTGGGATTGAGAAGGCTTTGAATGATAAGTCATCT
ACCTCCAACCTGAAGATTGAAGCCCTTGTATTTACAAGACTTGTTATGGCTTCACATTCC
CCAGCTGTGTTTCATCCATACATACAGGCCCTTTCTGGCCCAATATTGTCTGCTATTGGA
GACAGATATTACAAAGTCACCGCTGAGGCTTTAAGAGTCTGCGGAGAGCTAGTTCGTGTA
CTTCGTCCAAATTTTGAGGCACGCACTCTAGATTACAGGCCATATATTGGTCCAATCTAT
AAGGCTATCTTGGCCCGCTTGGCAAATCAGGATCAGGATCAGGAAGTTAAAGAGTGTGCC
ATATCTTGCATGAGCCTTGTGGTATTCACGTTTGGTGATGGTCTCCAAAGGGAACTGCCG
GCATGCCTTCCCATTCTTGTTGATAGAATGGGTAATGAAATAACTAGACTTACAGCAGTT
AAGGCGTTTGCAGTGATTGCTAAATCACCTCTTCGCATTGATCTTTCGTGTGTCCTAGAC
CATGTCATTTCTGAGCTCACGGCTTTCCTTCGAAAGGCAAACAGAGCTCTAAGGCAGGCT
ACATTGGGAACACTAAATTCTCTTGTTGTTGCGTATGGTGGTCAAATTGGATCCTCTTAT
GAAACTATTATTGCTGAACTTTCTACGCTCATTAGTGACATGGATTTGCACATGACTGCT
CTTGCGCTGGAACTTTGTTGCACGATCATGGTCGATAGAAAATCCATCCAAAATGTTGGT
CTTGCAGTGAGGTACAAGGTTTTGCCCCAGGCCCTTATTTTGATCAGGAGTGCTCTCTTG
CAAGGGCAGGCACTACAGGCACTGCAGAGATTTTTTGCTTCACTGGTCCAGTCTGCAAAT
ACAAGCTTTGACACTTTGTTGGATTCTCTTATTTCTACTGCTAAACCATCGCAGTCAGGT
GGACTTGCCAAACAAGCATTGTCTTCCATTGCACAGTGTGTTGCTGTGTTGTGCTTAGCA
GCTGGGGATCAGAAGTGTGCCTCAACTATTGAAATGCTTAAAGGCATTTTAAAAGATGAC
AGCACTACTAATTCTGCTAAACAGCACATGGCCTTGTTATGTTTGGGAGAAATTGGAAGA
AGGAAGGACCTCAGCAATCATGCTCAAATTGAGAATATTGTCATTGAGTCATTTCAGTCA
CCTTTTGAGGAGATCAAATCTGCAGCGTCATATGCTCTCGGAAACATTGCTGTTGGAAAT
TTATCGAAGTATTTGCCTTTTATCTTGAATCAGATTGACAACCAACAGAAGAAACAGTAT
CTATTGCTTCATTCACTGAAAGAGGTAATTGCACGGCAGTCTGTTGACCATACTGGCCAG
AGTGAGCTCCAGGATTCAAACATTGAGAAGATTTTGGCATTGCTCTTTAATCACTGTGAA
AGTGAGGAGGAAGGAGTTCGGAATGTAGTTGCAGAATGCTTAGGCAAAATTGCTCTGATT
GAACCTAGGAAATTAATCCCTGCTCTAAAGGAACGCACATCTAGTCCTGCTGCAAACACA
AGAGCTACAGTTGCCATTGCTATAAAATATTCAATTGTTGAACGGCCTGGAAAAATAGAT
GAAATTATGTACTCCGAGATTTCTACCTTCCTGATGTTGATTAAAGACAGTGACAGGCAC
GTGAGGCGTGCAGCTGTGCTGGCCTTGAGTACAGCTGCCCACAACAAGCCAAATTTGATT
AAGGGTCTTCTTCCTGAATTATTGCCTCTTTTGTATGACCAAACTGTTGTTAAGCAAGAA
TTGATCAGAACAGTTGACCTTGGGCCTTTCAAGCATGTTGTGGACGATGGTCTTGAACTC
AGGAAAGCTGCCTTTGAATGTGTGGATACATTGCTGGATAGCTGTCTTGATCAAGTGAAC
CCATCATCATTTATCGTTCCTTTCCTCTTATCTGGTTTAGGTGATCATTATGATGTAAAA
ATGCCTTGCCATCTGATTCTCTCAAAGCTAGCAGACAAGTGCCCTTCTGCTGTTCTGGCA
GTTTTGGACTCATTAGTTGACCCCATTGAGAAAACTATAAATCACAAACCCAAGGGCGAT
GCAGTGAAGCAAGAGGTTGATCGCAATGAAGACATGATTCGAAGTGCTCTTCGAGCAATC
GCTGCTCTAAGCCGCATAAGTGGTAATGATTACAGCATGAGGTTCAAGAATCTGATGAAC
AAGATAATGGCCTCACCTCCGCTTGCTGACAAGTACAACTCGGTGCGCAGCGAGTAA

Protein

1219 aa

>Os02t0167700-01 Homolog of Arabidopsis CAND1, Auxin signaling to maintain the G2/M cell cycle transition in crown root meristem, Required for crown root emergence
MANMNITTILEKMTGKDKDYRYMATSDLLSELNKEGFKADQDIEPKLTTTVLQQLEDASG
DVSGLAVKCLAPLVKKVGEDRVVEMTNILCDKLLNGKDQHRDTASIALKTIIVEVTTTSL
AEKILVSLAPQLIKGATAGKSAEVKCECLDILGDVLHRFGNLITKDHDSMLTALLSQLSS
NQASVRKKSISCIASLAACLSDDLLAKATFEVVQLLKNRSAKSEIARTNIQMIGALSRSV
GYRFGPHLAEAVPLLINYCTSASENDEELREYSLQALESFMLRCPRDISPYCEGILNLAL
EYISYDPNFTDSMEEDTDDEAQDEEDDDESANEYTDDEDASWKVRRASAKCLSAIIVSRP
EMLSKMYLEACPKLIERFREREENVKMDIFNTFIELLRQTGNMTKGQGDIDESSPRWLLK
QEVPKVVKSINRQLREKSIKTKVGAFSVLKELVVVLPDCLADHIGSLVPGIEKALNDKSS
TSNLKIEALVFTRLVMASHSPAVFHPYIQALSGPILSAIGDRYYKVTAEALRVCGELVRV
LRPNFEARTLDYRPYIGPIYKAILARLANQDQDQEVKECAISCMSLVVFTFGDGLQRELP
ACLPILVDRMGNEITRLTAVKAFAVIAKSPLRIDLSCVLDHVISELTAFLRKANRALRQA
TLGTLNSLVVAYGGQIGSSYETIIAELSTLISDMDLHMTALALELCCTIMVDRKSIQNVG
LAVRYKVLPQALILIRSALLQGQALQALQRFFASLVQSANTSFDTLLDSLISTAKPSQSG
GLAKQALSSIAQCVAVLCLAAGDQKCASTIEMLKGILKDDSTTNSAKQHMALLCLGEIGR
RKDLSNHAQIENIVIESFQSPFEEIKSAASYALGNIAVGNLSKYLPFILNQIDNQQKKQY
LLLHSLKEVIARQSVDHTGQSELQDSNIEKILALLFNHCESEEEGVRNVVAECLGKIALI
EPRKLIPALKERTSSPAANTRATVAIAIKYSIVERPGKIDEIMYSEISTFLMLIKDSDRH
VRRAAVLALSTAAHNKPNLIKGLLPELLPLLYDQTVVKQELIRTVDLGPFKHVVDDGLEL
RKAAFECVDTLLDSCLDQVNPSSFIVPFLLSGLGDHYDVKMPCHLILSKLADKCPSAVLA
VLDSLVDPIEKTINHKPKGDAVKQEVDRNEDMIRSALRAIAALSRISGNDYSMRFKNLMN
KIMASPPLADKYNSVRSE*

5'UTR

chr02:3669031..3669323 (- strand) : 293 bp

chr02:3668581..3668636 (- strand) : 56 bp

CDS

chr02:3668545..3668580 (- strand) : 36 bp

chr02:3668273..3668442 (- strand) : 170 bp

chr02:3667653..3667860 (- strand) : 208 bp

chr02:3666166..3666331 (- strand) : 166 bp

chr02:3665934..3666063 (- strand) : 130 bp

chr02:3665598..3665712 (- strand) : 115 bp

chr02:3665360..3665517 (- strand) : 158 bp

chr02:3665155..3665278 (- strand) : 124 bp

chr02:3664911..3664961 (- strand) : 51 bp

chr02:3664745..3664827 (- strand) : 83 bp

chr02:3664504..3664588 (- strand) : 85 bp

chr02:3664340..3664441 (- strand) : 102 bp

chr02:3664165..3664263 (- strand) : 99 bp

chr02:3663977..3664087 (- strand) : 111 bp

chr02:3663816..3663899 (- strand) : 84 bp

chr02:3663598..3663738 (- strand) : 141 bp

chr02:3662979..3663071 (- strand) : 93 bp

chr02:3662751..3662869 (- strand) : 119 bp

chr02:3662514..3662676 (- strand) : 163 bp

chr02:3662199..3662435 (- strand) : 237 bp

chr02:3661475..3661723 (- strand) : 249 bp

chr02:3661206..3661391 (- strand) : 186 bp

chr02:3660959..3661105 (- strand) : 147 bp

chr02:3660760..3660876 (- strand) : 117 bp

chr02:3660489..3660657 (- strand) : 169 bp

chr02:3660164..3660241 (- strand) : 78 bp

chr02:3659926..3660064 (- strand) : 139 bp

chr02:3659567..3659663 (- strand) : 97 bp

3'UTR

chr02:3659299..3659566 (- strand) : 268 bp

FASTA

>Os02t0167700-01 class=Sequence position=chr02:3659299..3669323 (- strand)
AATCCCCCAT CGGCGTCAGG GCCGTGACGG CAAAAAATAC AGCGAGCTCT CCAAGCCCTA GCCGCCGCCC GCCCGCCTCC
CCTTCCCGAC CCCTCGCCGC CGGCGAGCCG GCCGCGTGGA GTCGCCCCCC CGCCGCGGTT CCCGCCGTCC GCTACGTTGT
CTCGGGCCCC GGAGTGCTGG GATCGCGCCG CGTGCTGGAC TCACTGGACT GGACTGGAGA CGCCGCCCTC CGCTCGACTA
GCCCCCACCC CCCACCGGCG TCGTCGTCGT CGTCAAGGGC TCACCATCGC TAGGTTGGTA CCTCCGGTTG GTTGGTTGGT
TTGTTTCGCT GCTTCGACTG GTTTTCTGCA GGCGTGATGT GGTTCTAGGG CTTTGAACCC GAGGTGCCCG ATCCGAATGA
TTCGCTCGTG GCGTTAGGTT TTCGGTTCTG TATCGCCGTA GATCTAGCAG GGAGGAGGAT CTTCTGATTT TCCGAAGTGG
GGGTAGAATA GAGCACACCA CACCATCACG CCCACCTCCT TTTTAAAGGA GCGAGGAACT GAGGATTCTC ACTGTGATCG
TGAACTGGAG TTTGGCAGTG GATGAGTTTT GCATCTGTGC CAGCATGCAA ACACTCAACA ATGTGCGCTG TTCACCTTGC
CAGTAATGGA ACTTAATCTC ATTATACTTG ATTTTTGTTA TTTCCAGCAG GGCAACAGTG ATTAGTTCCG CGGAAAAGGA
CTTTTGGATA CGGTTTAGCT AAAATGGCAA ACATGAACAT AACCACCATC TTGGAGAAGG TATGGGTTTC ACTGATCTGC
ATGTGAACTG TAAACCTGAA TTTTGCTCTT TATTTTTCTA TGATTTGATC TTAACATCCG TTGTGTAAAA TTTTCTTTCA
GATGACAGGG AAAGATAAGG ACTACAGATA TATGGCAACT TCAGATTTGC TTAGCGAATT GAACAAAGAG GGCTTCAAAG
CTGACCAAGA CATCGAGCCA AAGTTGACTA CTACCGTTCT TCAACAACTG GAAGATGCTT CAGGAGATGT CTCTGGTTTA
GCTGTTAAAT GGTATGCATT AATTGCTTTC TCCCTTTATT GAGAGCGGTA TCGTCTGATT AGCATTTTGT TTTGTTAATG
GTGATCATCC GCTCCTTATT GCAAGAAATC ACTGTCATTT GGATCTCGCT ACTTTTGTAA TTTATGTTAG TTGCAGTTGC
TATTGTTAAG GATTTGTACT GCCTCATTCA ATTTTCTGGA CTAATATAGG GCATTGATTA TTACAGTAGA TGTTTTTTTT
TTCTGTATAT ATCTCTAACT GCTGTTTTTT TCACTGCAAC TTCATGCCTC AATTATTGCA TCCATTGAAG CACATTTAGT
ATAGCAATTT GATACCCAAT TGTTCTGTTA TGTTTTCCAC ATTCCGGTGT TCTGCACTTC ATGGTTTGCT ATGTTAATCT
GTATTATTAC TTCTCTTGGT TAGCTTGGCT CCACTTGTCA AGAAGGTTGG TGAGGATAGG GTGGTGGAGA TGACCAACAT
TCTTTGTGAT AAGTTACTCA ATGGAAAGGA CCAACATCGA GACACTGCTA GTATTGCTCT GAAGACAATC ATTGTGGAAG
TTACGACAAC ATCACTTGCT GAAAAGATTT TGGTGTCTCT TGCCCCACAG CTAATCAAGG GCGCCACTGC TGTAAGTTCT
CAATTCGTCT CCTAATTGTG GTAAAACATG CTTCCATATT AATCTTGCGG CGGGTGCCAT TCGAACCATA TAGTTTGTAT
TTGCTATTAC AATAATGGTT GTCAAGTCGT AAAGTCGAGT CGAGGTACCC CTGGACCGAC TTGGTCGACT AGTCCATGAC
TTGGTCATGC AAAAAACAGG GGATGCAATA TATAATCTTT ACTACTATTA TACTGTGCTA AGAAATGTAT GGAGTATAAA
CTATGGACTA TGGAGTAGCA AAGCAAGACA ATAGGTCAAC AAGAAATAAA ACTAAAGTAC TAAACACAAT AAGCCAATTA
GCATGGTGAA TTGGTGATTT GCTACGACTA ATCACGACTA ATTTACGACC GACTTTATGA ctaatctacg actaaccacg
acttaccacg actaatcgca cgacttgctg tttggtcgag tcgtggctct ttagtcgact agcttgactg actttacgac
taatctatga ctaatcacga ttagtcgggc gacttgataa cagTGATTAC AATTGAAAGT TTCAGCCTGC TAATTAAGTT
TACAGCGTTT CTGATGGTGC ATTATACTTT TGAGGTATAC CAAAGAACAC ATTTGCAAAC CTTGTAACTA TGTATTTATT
TTTACCTCCC TATTCATCCA GTCTGGTTAG GTGTTCAGCC ATGTTTGCTT GCCATATTCA ATTGAAGTCA TTATATGCTG
GCTTCACAAC TTCAGAATTA TGTTAGCAGC ACAGAGAGCC AAAAAGAAAT TGTGTTTTAA CATTTGTTTT TAGTTTGAGA
GCCATGATAG TAAGTGCCAT GGTACAGTAC CTTCCGCTAC TGCAGAAAGT TGGATAGTTT TCCAGACCAG TCAATATTTT
TAGATTTTTC TAGCCACCAT AAATTTCAAA CCGCAATTTT AGCTACTGCA GCAAATACAA TGCAAATGAT AAACCATGAG
CAATCTTTTC TTTGGATAAA TTAATTAGGA AACTGTGCTA CCCTTCCTAA CACATGATAG ATTTTAGCTG CAAATCTGGC
AATGATGCTG ACCATGCACA GTCCATGAGG TTTTATCTGT CAATTTCTAG CTATCCACAT AACTATAAGA ACACATTAGC
TTTCACCTAT GCGTCTTTAC CTTAAAAAAA CAAGAGCGGT TTATTGAATT GCCTTTGCCA GCACATCATG TTTAACACCT
GCCTATAATA GATAAACCAA TATATGGATT TTGGGGCTTA GTAGCATATA CTTGGTTTTG TCATACCATG GGATGTCTTG
GGTAGGTTTG ATAACTCTTC TTTTGTTGAC AGGGAAAAAG TGCGGAAGTG AAATGCGAGT GCCTTGATAT ATTGGGGGAT
GTACTTCATA GATTTGGCAA CTTGATCACA AAAGATCATG ATAGTATGCT CACTGCCTTG TTATCCCAGT TGAGCTCTAA
CCAAGCAAGT GTTAGGAAAA AGTCTATTTC TTGCATTGGT AAGTCGAACT GATGTGCTGT GCTGTTATAT GTTGGTTTTT
TGGGTGGCTT GAATTTGTAA AGGTGTTTAC ACTGACTGTT AACATGCTAT TTTTCTTCAG CATCACTTGC TGCATGTCTG
TCTGATGATT TATTAGCCAA GGCAACTTTT GAGGTTGTCC AGTTGCTTAA AAATAGAAGT GCAAAGTCTG AAATTGCCCG
AACAAATATC CAGATGATTG GCGCTCTAAG GTATATACTT TGGCTTTCAA CTGTACATGT ATGCCTTGAG TAGTTCTTTT
AAGGAACAGG GCACACTCAT TTGTTCGCAA TAGCTTAGAT GAAATCATGT TCACGCTTCA AACTTATCTA GCCAGTTGAA
ATCCAGATAT TTACTATTTT TTGGCGATTT AGTGGTTCTT ATCTGGTGTG CGGCAATCCA AGTTTTGATT CAATATTATT
TTCATTTACA GTCGCTCGGT TGGATACCGT TTTGGGCCAC ACCTTGCTGA AGCTGTTCCT TTGCTCATAA ACTATTGTAC
AAGTGCATCG GAAAATGATG AAGAGCTCCG TGAATACAGC TTGCAGGTGA ACAATTTTCT TCTTTCCAAT GTTACATGAA
ACGAGTGTTC TCTTGTATGA CTCCTGTGGG TTTTTCCATA ATGTAGGCCC TCGAGAGTTT TATGCTGAGG TGTCCAAGAG
ATATATCTCC ATATTGTGAG GGTATTTTAA ATCTTGCATT GGAATATATA AGCTATGATC CAAATTTCAC TGATAGCATG
GAGGAGGACA CTGATGATGA GGCTCAGGAT GAGGAAGATG ATGAGTACGT AATTGATGCT CTTACAGTAA TAGATAAATA
GCATCTGTTT ACTTGATCAA AATATGTTTT CGATATTTTC TCCAGTGAGA GCGCAAATGA ATACACAGAT GATGAGGATG
CAAGCTGGAA AGTCCGGAGG GCTTCAGCAA AGTGCTTATC TGCAATTATA GTATCTCGTC CTGAAATGTT GTCTAAGATG
TATCTGGAGG TATATTGACA TAATCATGTT AAACCAACAT ATGATCATCT GAAAAATGTT CTGTTTGATG GCATGTTTAA
ATTTCTCCCA TGTTTCGGAT AGTGTTTCTG TAATGATTTT TACCAGTTAG TAATGTGACC CATTAGCTAA TAATGAGTGT
CCCATTTAAC TTCGATGTTT TTCTTTTTTA AAAAATATGC AGGCTTGTCC AAAGTTAATC GAACGGTTTA GGGAAAGAGA
GGAAAATGTA AAGGTAATTG CTTTGTATCA ATAATTTGTC AGTCTCTGAG TTTTCTTTCT GTTTGTCAAT CTGATGAAGC
TTCTATATGA TTCTAGATGG ACATCTTTAA CACATTTATT GAGTTGTTAC GCCAAACTGG TAACATGACA AAAGGACAAG
GTGACATTGA TGAGTCTAGG CAAGTCTATT GTGCTCTTAT GTGCATCATT ATTTTCAACT TCTCCAAGTT ATAGCATCTT
ATGCAGTTTA TTGGTGAAAT ACTTTTACAT GCTTGAAGTT GATCCTACCA TGTTTAGAGC ACTGAGCCCA TGTTGGCAAT
CCTTTTGCTT TTCAGCCCTA GATGGTTGCT GAAACAAGAA GTACCTAAGG TTGTCAAATC CATCAATAGG CAGTTGCGTG
AAAAATCAAT CAAGACAAAG GTGAGCTCTT TGACTGCAAA TCATGTCTAT CGACCTGGTT CTGATTTTAG ATAAAATTTC
AGGTTGGAGC ATTCTCTGTA TTGAAGGAGC TTGTTGTTGT ACTGCCAGAC TGTCTTGCTG ATCATATTGG GTCACTTGTT
CCTGGGATTG AGAAGGCTTT GAATGTTGGT GATTCCCATT TTGCTTAAAA TATTATGTGC AGGACTTCTA CTTGTTGCTA
ACTTGTTTTC TTTTTCATAG GATAAGTCAT CTACCTCCAA CCTGAAGATT GAAGCCCTTG TATTTACAAG ACTTGTTATG
GCTTCACATT CCCCAGCTGT GTTTCATCCA TACATACAGG TAACTGTAGC GTATATCTTC AGTAAAATAT ACTTATGGCA
TTTGTCATCA TTGTATTGAT CGTAGTGAAA TTCCAGGCCC TTTCTGGCCC AATATTGTCT GCTATTGGAG ACAGATATTA
CAAAGTCACC GCTGAGGCTT TAAGAGTCTG CGGAGAGCTA GTTCGTGTAC TTCGTCCAAA TTTTGAGGTC AATCTTGTAT
TTCATATGTT GCTGAACAAA ATCTAAGTTC TGTTTCTTGA AGCCTTTGTT TGTTTGTGAT ACAGGCACGC ACTCTAGATT
ACAGGCCATA TATTGGTCCA ATCTATAAGG CTATCTTGGC CCGCTTGGCA AATCAGGATC AGGATCAGGT TGAGCAAAAT
TAACACCTCC CTATCTTCAT CTGTCTCTTT CTCTCTCAGG TCTCTTATGG AAATATTTGT TTCAGGAAGT TAAAGAGTGT
GCCATATCTT GCATGAGCCT TGTGGTATTC ACGTTTGGTG ATGGTCTCCA AAGGGAACTG CCGGCATGCC TTCCCATTCT
TGTTGATAGA ATGGGTAATG AAATAACTAG ACTTACAGCA GTTAAGGTAA GCTATCGACT GCACCTTTAC TGACAGATAG
GATTGCTTAA TCTCCTTATT GATTCATTAC TTATGAGCAC TACTTGTTTT CTTTAACACA ATTATATTTT AGTCTTAATT
GACTTGTTTT ATGGAACACA ATTTTGTTTT AGTCTCAGTT TGAAGATTTT AGTAGGAAAG AATAGTTAAC TAAACCCATA
CCCCCAAGCG TATCTCAATA TTCTGGTCAA TGATGTTAAA GGAACTACGA GTGTTTTGAT AAGTGCTGGT TTCACATCTC
ACTAGATTGC CTGAAAGAGA AATTGTGTTG TAGTTGGTCC ATTGTGATGC AAACTTAGTT GAAACGTATT TTACCAATCT
ATTTGCTCAG ATCATTTCCT CAGAATTTTA ATGATATAAC CTATTATCAC TTGCTTAATG CCTACATTTG AAATTAGAAG
TTCTTTTTTC TATATTTGCC TGATTTTTTC AATCGAGTGC CTATTTGTTT TGTTGATCTG CTCGGTACAT AAAATGTTTT
TCCCCTTTAC AGGCGTTTGC AGTGATTGCT AAATCACCTC TTCGCATTGA TCTTTCGTGT GTCCTAGACC ATGTCATTTC
TGAGCTCACG GCTTTCCTTC GAAAGGTATA CCCAGTGTTT ACTTTGTTTT GTCACGATTC ATGGGAAAAC TTTTTAAATA
ACAGTTATGA AACTTGTTCG CTAAGTTTTA TTTGATGCAC ATTTATTTCA ACAGGCAAAC AGAGCTCTAA GGCAGGCTAC
ATTGGGAACA CTAAATTCTC TTGTTGTTGC GTATGGTGGT CAAATTGGAT CCTCTTATGA AACTATTATT GCTGAACTTT
CTACGCTCAT TAGGTTTGTT GTTATTCATC AATCCTGCAT TTTCTGGCTA CCATGACGAC TGGTGCTGAC CTGATTTACT
GTGGCAGTGA CATGGATTTG CACATGACTG CTCTTGCGCT GGAACTTTGT TGCACGATCA TGGTCGATAG AAAATCCATC
CAAAATGTTG GTCTTGCAGT GAGGTACAAG GTTTTGCCCC AGGCCCTTAT TTTGATCAGG AGTGCTCTCT TGCAAGGGCA
GGCACTACAG GTATTTTTTT TTTCATTTAC ATATTTGATT TCTTCTTAAG TTGCATGTTG ACACTAACAT GGGATGTTAC
TGCCACAGGC ACTGCAGAGA TTTTTTGCTT CACTGGTCCA GTCTGCAAAT ACAAGCTTTG ACACTTTGTT GGATTCTCTT
ATTTCTACTG CTAAACCATC GCAGTCAGGT GGACTTGCCA AACAAGCATT GTCTTCCATT GCACAGTGTG TTGCTGTGTT
GTGCTTAGCA GCTGGGGATC AGAAGTGTGC CTCAACTATT GAAATGCTTA AAGGCATTTT AAAAGATGAC AGCACTACTA
ATTCTGTAAG GCGCATTCTT GATGACAGAT GTGTTGTTTA ACTTCTGTAC TGTTTCACTT TTATGTAGTA CTTCTGCTCT
TTGGTATAGT GCATGCCATA TCTTGGTGAT CCTTTTAAGT TAGTTATATA GATTTTCATA TATCAACATC TTTTATATGT
AGATAATGTT ATAACTCTAT AGCGTTGTGA AATAGGATAC TACATTCTCT CTTAACTAGT TTCCTATGCC TTCGACAATT
TTGAAAAATG ACTATGCTGA ATTGGAGGGA TCATGCTTTA TTTTTTTCAA TTTGATAGGA TCACCCTAAA TTGTATAGTC
TGAAAGTCCT TGGTAACTGT TGATGTGCTT GTTTGATTCT GATCCATGAA AATTGCCATT GAAGTATTAG TTATTTATTA
ATTGCATGAA TTCAAATAAC TCAAATATGA TCTCTATCAT TCTCCTTGTA TTCAGCTGAC TGCCTATCTT TGTTTACCAG
GCTAAACAGC ACATGGCCTT GTTATGTTTG GGAGAAATTG GAAGAAGGAA GGACCTCAGC AATCATGCTC AAATTGAGAA
TATTGTCATT GAGTCATTTC AGTCACCTTT TGAGGAGATC AAATCTGCAG CGTCATATGC TCTCGGAAAC ATTGCTGTTG
GAAATTTATC GAAGTATTTG CCTTTTATCT TGAATCAGAT TGACAACCAA CAGAAGAAAC AGTATCTATT GCTTCATTCA
CTGAAAGAGG TTTGTCCCCA TTAGGATTTG GTTTGATGTG CATTCTCCAT GTATTTGTTG CTTAATTCTT GCTTGTACTT
TAAATCACTC AGGTAATTGC ACGGCAGTCT GTTGACCATA CTGGCCAGAG TGAGCTCCAG GATTCAAACA TTGAGAAGAT
TTTGGCATTG CTCTTTAATC ACTGTGAAAG TGAGGAGGAA GGAGTTCGGA ATGTAGTTGC AGAATGCTTA GGCAAAATTG
CTCTGATTGA ACCTAGGAAA TTAATCCCTG CTCTAAAGGT GAAATGGGAT TACTATCTAA ACTATTTTCT TCATTTTGTT
CTACTGTCAT TTAATGATTA GAGGTCTTTT GGTTCATTCC TTGCGTTTTT TTTTGTAGGA ACGCACATCT AGTCCTGCTG
CAAACACAAG AGCTACAGTT GCCATTGCTA TAAAATATTC AATTGTTGAA CGGCCTGGAA AAATAGATGA AATTATGTAC
TCCGAGATTT CTACCTTCCT GATGTTGATT AAAGACAGTG ACAGGGTATG GAAATTAAGC ACAGTTCAGC GTTTTTACTT
AATGCTGTCT AGATGTGGTG TTCATTGTTT CCTTTTGCAC TTTGCAGCAC GTGAGGCGTG CAGCTGTGCT GGCCTTGAGT
ACAGCTGCCC ACAACAAGCC AAATTTGATT AAGGGTCTTC TTCCTGAATT ATTGCCTCTT TTGTATGACC AAACTGTTGT
TAAGGTATAG TTTCTTATTG ACTTCTTGTT TTGTTGTGAG CTAGGACTGT TATATCAAGT AATGTTTTTT GTATCCATCT
TATCGTAATG ATTTTTTCCT GTGCAGCAAG AATTGATCAG AACAGTTGAC CTTGGGCCTT TCAAGCATGT TGTGGACGAT
GGTCTTGAAC TCAGGAAAGC TGCCTTTGAA TGTGTGGATA CATTGCTGGA TAGCTGTCTT GATCAAGTGA ACCCATCATC
ATTTATCGTT CCTTTCCTCT TATCTGGTTT AGGTGGTAAG TACTGTTACA CTAAATAATT TATCACTTTG ACCGAACATT
CCGTTTAATC CACTGTAGTA ATATAGATGT ATAGGTGGTG TGTAATCTTT AAAACCTTTA CACCGCACAC AAATAAGTCA
TGTTTATTTT GTTTACTTGT TCGCAGTGCT TTTTTCACTA GTATTCGTAT CTTCTTGTTT ATGCTTAGTA TACACACGCT
GTAATAACTG CTTTTTTGTT GTCTTATGGA ACCACTTTGT AGATCATTAT GATGTAAAAA TGCCTTGCCA TCTGATTCTC
TCAAAGCTAG CAGACAAGTG CCCTTCTGCT GTTCTGGCAG GTTTGTTGCC TTAATCTAGG TCCTTACGGG GATGTTTCAT
ACGATGCAAA TGCCCTACTC TGAGTTCTTT TTGCTAATAT TCTTACTATG CTGTCTCAGT TTTGGACTCA TTAGTTGACC
CCATTGAGAA AACTATAAAT CACAAACCCA AGGGCGATGC AGTGAAGCAA GAGGTTGATC GCAATGAAGA CATGATTCGA
AGTGCTCTTC GAGCAATCGC TGCTCTAAGC CGCATAAGGT CAGGCATCAT TCTGTCCTGC CCCGAACACT TTTTTTCTGG
TTTAACCACA CTTTTAACTG TGCTGTCATC TTTCTCGTTA TTAGTGAATC GCCACATCTT TATTCTTTGC CCTTGATAAG
CGATAACTAG AAACAAATGG TTACCTCATT TTACTTGCGA TACAGCCATT CTATACATGC CATATGTTTG TTCGAAAGTG
ACATCTGCAT TCTAATTTGA GTATCTTACC TTGTTTTGAT CTTTTGGGTT ACGTCTGCAG TGGTAATGAT TACAGCATGA
GGTTCAAGAA TCTGATGAAC AAGATAATGG CCTCACCTCC GCTTGCTGAC AAGTACAACT CGGTGCGCAG CGAGTAAGAG
CTGATCTTTT TGTATATGGT AGAAAATAGT TGGAGCCGAC TTGGTATATG TGCCACTGCC TATTCTGAGG TGAAGATTCA
ACCCAGCATT GCCCTATATT TTTCTGGTGG AGCTAGTCCG AAACACTGAA CGATACAGCT GAGACTAAGA GGTGGTTTGA
AAATTTGCGA ACACAAATGG CTGGTTGGAA GCTAGACTTT TTTTTTTTGT CTTGTACAAA GTATGGCGGC AATTCACTAG
ATTCAGTAAA GTTGGATTAT ATTTT

Locus: Os02g0167700

Loading...

Locus: Os02g0167700

Loading...