Os02t0170500-01

Locus

Os02g0170500

Description

Histone-fold domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

HAP5A

CGSNL Gene Name

HAP5A SUBUNIT OF CCAAT-BOX BINDING COMPLEX

Oryzabase Gene Symbol Synonym(s)

OsHAP5A, NF-YC, CBF-C, OsNF-YC1, Os-NF-YC1, NF-YC1, NFYC1, OsNF-YC4-2, NF-YC4-2

Oryzabase Gene Name Synonym(s)

Nuclear factor Y C1 subunit, Nuclear factor Y C subunit 1, NUCLEAR FACTOR-Y subunit C1, NUCLEAR FACTOR-Y subunit NF-YC1, NF-YC subunit 1, NF-YC family 1

Transcript Evidence

AK243429 (DDBJ, Best hit)

Protein Evidence

C0PEA5 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Cellular Component: intracellular (GO:0005622)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: sequence-specific DNA binding (GO:0043565)

Functional domain (InterPro)

Transcription factor CBF/NF-Y/archaeal histone (IPR003958)

Histone-fold (IPR009072)

Full-length cDNA

J100067L16 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0170500-01)

Others

Oryzabase (8491)

KEGG (Os02t0170500-01)

Transcript

1238 bp

>Os02t0170500-01 Histone-fold domain containing protein.
AGGGCGACCGCGTCTCCCTCTCTCTCTCTCTCTCCGCCGCCGACGCCGAGGGCTCCACGA
GAGGGAGGTGGGCGGCGCGGCCCTTCGCCGGAGGGAGCGCTCTCCGCCGCCGCCGCTCCC
GCTCCCGCCGGCGCGGGAGATCCGGGCGTCGTCTCTCGGGCCTTTGGCTTTGGACGGACA
AGAGCTGACATGGAACCATCCTCACAGCCTCAGCCTGTGATGGGTGTTGCCACTGGTGGG
TCACAAGCATATCCTCCTCCTGCTGCTGCATATCCACCTCAAGCCATGGTTCCTGGAGCT
CCTGCTGTTGTTCCTCCTGGCTCACAGCCATCAGCACCATTCCCCACTAATCCAGCTCAA
CTCAGTGCTCAGCACCAGCTAGTCTACCAACAAGCCCAGCAATTTCATCAGCAGCTGCAG
CAACAGCAACAGCAGCAACTCCGTGAGTTCTGGGCTAACCAAATGGAAGAGATTGAGCAA
ACAACCGACTTCAAGAACCACAGCTTGCCACTCGCAAGGATAAAGAAGATAATGAAGGCT
GATGAGGATGTCCGGATGATCTCGGCAGAAGCCCCCGTTGTCTTCGCAAAGGCATGCGAG
GTATTCATATTAGAGTTAACATTGAGGTCGTGGATGCACACGGAGGAGAACAAGCGCCGG
ACCTTGCAGAAGAATGACATTGCAGCTGCCATCACCAGGACTGATATCTATGACTTCTTG
GTGGACATAGTTCCCAGGGATGAAATGAAAGAAGAAGGGCTTGGGCTTCCGAGGGTTGGC
CTACCGCCTAATGTGGGGGGCGCAGCAGACACATATCCATATTACTACGTGCCAGCGCAG
CAGGGGCCTGGATCAGGAATGATGTACGGTGGACAGCAAGGTCACCCGGTGACGTATGTG
TGGCAGCAGCCTCAAGAGCAACAGGAAGAGGCCCCTGAAGAGCAGCACTCTCTGCCAGAA
AGTAGCTAAAGATGATACAGTGAAGTTGTGACATTGATATACATTGTCCTGTGAACTTAG
GGCCTCTAAAACTCAGTGCTCTTGTCAAAACTATTCCCATGATTGTTGGCTGAAACGGGT
AATCTGATTAGGTCTTAGGCTTTCCTAATGTTAGTTCTGCTCTGCTATGGCAGCAGTAGA
AAAAAAAAAGATTGTGATTTGGTAGGTGATTTGCAACTAATGTAGTAACTGTACCTTACC
TTTCATCAGTTTCTAATCCAATACTCAAAAGTGCTGGC

CDS

780 bp

>Os02t0170500-01 Histone-fold domain containing protein.
ATGGAACCATCCTCACAGCCTCAGCCTGTGATGGGTGTTGCCACTGGTGGGTCACAAGCA
TATCCTCCTCCTGCTGCTGCATATCCACCTCAAGCCATGGTTCCTGGAGCTCCTGCTGTT
GTTCCTCCTGGCTCACAGCCATCAGCACCATTCCCCACTAATCCAGCTCAACTCAGTGCT
CAGCACCAGCTAGTCTACCAACAAGCCCAGCAATTTCATCAGCAGCTGCAGCAACAGCAA
CAGCAGCAACTCCGTGAGTTCTGGGCTAACCAAATGGAAGAGATTGAGCAAACAACCGAC
TTCAAGAACCACAGCTTGCCACTCGCAAGGATAAAGAAGATAATGAAGGCTGATGAGGAT
GTCCGGATGATCTCGGCAGAAGCCCCCGTTGTCTTCGCAAAGGCATGCGAGGTATTCATA
TTAGAGTTAACATTGAGGTCGTGGATGCACACGGAGGAGAACAAGCGCCGGACCTTGCAG
AAGAATGACATTGCAGCTGCCATCACCAGGACTGATATCTATGACTTCTTGGTGGACATA
GTTCCCAGGGATGAAATGAAAGAAGAAGGGCTTGGGCTTCCGAGGGTTGGCCTACCGCCT
AATGTGGGGGGCGCAGCAGACACATATCCATATTACTACGTGCCAGCGCAGCAGGGGCCT
GGATCAGGAATGATGTACGGTGGACAGCAAGGTCACCCGGTGACGTATGTGTGGCAGCAG
CCTCAAGAGCAACAGGAAGAGGCCCCTGAAGAGCAGCACTCTCTGCCAGAAAGTAGCTAA

Protein

260 aa

>Os02t0170500-01 Histone-fold domain containing protein.
MEPSSQPQPVMGVATGGSQAYPPPAAAYPPQAMVPGAPAVVPPGSQPSAPFPTNPAQLSA
QHQLVYQQAQQFHQQLQQQQQQQLREFWANQMEEIEQTTDFKNHSLPLARIKKIMKADED
VRMISAEAPVVFAKACEVFILELTLRSWMHTEENKRRTLQKNDIAAAITRTDIYDFLVDI
VPRDEMKEEGLGLPRVGLPPNVGGAADTYPYYYVPAQQGPGSGMMYGGQQGHPVTYVWQQ
PQEQQEEAPEEQHSLPESS*

5'UTR

chr02:3849956..3850113 (- strand) : 158 bp

chr02:3847272..3847302 (- strand) : 31 bp

CDS

chr02:3846492..3847271 (- strand) : 780 bp

3'UTR

chr02:3846223..3846491 (- strand) : 269 bp

FASTA

>Os02t0170500-01 class=Sequence position=chr02:3846223..3850113 (- strand)
AGGGCGACCG CGTCTCCCTC TCTCTCTCTC TCTCCGCCGC CGACGCCGAG GGCTCCACGA GAGGGAGGTG GGCGGCGCGG
CCCTTCGCCG GAGGGAGCGC TCTCCGCCGC CGCCGCTCCC GCTCCCGCCG GCGCGGGAGA TCCGGGCGTC GTCTCTCGGT
AAGCCCCGCC TCCCGCCACC TTTCCTCGAT CTCTCTGTTC CCAATTCCGT GGGTGATCCC GTTTGGATTG TTGGCTGCAT
GCGTGGGTTG GGTGTTGCTA GCTTGGGGGG GGGGGAATTC TCTCTCGGCT CGTAGCTGAG GGAGGAATCA TCGCCTCTGT
TTCTAGGGCT GTGGAGCTGA TCCTGGCAGC ATATGGTTAG GTTTCGATTA GTCGTCGGCT TCGTTTCGAT TGCTTGATCC
TGCTTAGTTC TAGTTTGGAT TTTTAGTTTG CTATATGTGT GGAGAGACGT GCGGTCTCGT CTTGGTAAAT TTGTGTTCAT
GAGTGTTGAG TTGGTCCCGT GTCATGGCCG CCTTGCCACT GCCCAGAATT CTAACCCTAG CTTGTTTGCC GGAGTTCATG
AGCTCGCCGG AGAGGCGGAG GGTTTGTAGT TGCTGGTGTG GTGGCGCCGC GCCGGAGCCT TGGAAGGAGC TGCTGTAGAG
GAGAATTAGG TTTGATGTTC TCTTTGATTT GGGAATGGAG CTTACTAACT AGTGAAATGG AGCTTCAAAG AAGTGAGATA
ACCAAGATGC CCTCCTTCAC CATCGCGATC GTACTCTCCT CTGTTTCCGA TCTGCAGTGC GAGCTGGAGT TCCTCGCCTG
CGTGACTAGC AAGAAGCACG GTGTGGATGG ATGACCACCC TGGCCTTGCC CCGTGTTAGG TCCGCACCTG CATCTTCTTG
TAAGAACAGT GGGTCAACTC GTAGGAAACC ATTACCATGG TCAGTGATGA TGGATTGCTG ACGCGCGCTT AACGTAGTTC
TGCCACGAGT GCAAACTTCC TAGATGCAAG AGTACTGTTC TGATGCCACA TCTAAATTTG TTTATTTTGG TGTTGTTTTC
ATACTGTTAG GATCTCATGA TTTGCTGTCT AGATGTTCTG TCAAAACAGG GCACTCCTAA TTTCCTACCA TTCGTTGCAT
TGTTTTTTCA TGAAGTGATA TGATGATTTT CTCTTGGAGT GATATTTTCT CTTAGTGATG GATCATAATT ACATGATCAC
CCACATCGCG TATGTGTTAG GACGCTGCTC TCTTCTCTTT TTTTTTCCCT AAAAAAAGAC GTGATTGGTC CCATGCATTT
AATGAGTCTG AGTTTTGGAA TGTATCTAAA TTTGCCTTTT TCTGTGTTCA AATGTCACGT GACATGATAC GTGCCAACTT
TCCTTGTTTG TCCCAAATGT GTGGACCTCC TGGAACTACA AGATTGACAT ATTCTTCAAA GAATCCAATT AAGGTAGTTG
CACCCCAACC TTAAGCTTAA CCTGACAGCA CTTTATTTTA GTACTGATGG TGTGTCAAAC AGAGAGTAAG ATGGCAATTT
GGATCACTTG GCTTCTTGAT ATGTTGTTCA AAGTTAATAA TGACATAGCG GATCATTTTT AACATTTCTT ACATATTTAA
GTGTGCATTT TTTTTCCTAC TTGCTTGAAT GTTGTAGTCT TCTTTTACAC ACACTTCTGG TTGACATGGA AAAAAATATT
TATGAGATTT GGCATCTGGG TGTCATAGAC TTAATTCGGT TTGATGTAAG TAGATGAGAT GCTGCGAGTA AATTAGGAGG
AACACATAGC CATGGTATGA ACTGCCCTGC CATGACAGCT GCAACTGCAG CTGGGTAACT ACACCAAATC CAGGCCATCC
TTGGAGTGTT GGATATCCAA CAGTAGAGGG GAGAAAAAAA GCCTTGACTA GAAATACAAT TCATTCCGTA TTTTCCCATC
TCCCATCTCA GTTATCCAAA CATTGATTTG TCAGTCAATG AGCTAAAACC TGTGCAATTG GCTTGGAACT AGCCGATCTG
TGCCCTCTGG ACACAAATGC CATCATTCTG GGAGACTAAT AAGTCATAAC TGGAGCCATG GGGGCATAGC TACCTTTTGT
GGGTTATCTT TGGGACCTGC TTCTACCGGA AAACATCAAG ACATGTGATT TATGCTGTAC ATGCATGAGA AGCTTCAAAC
TCTGTATGAT GCATACTTAT CCATGTTGGT TTGTAATAGC AGCCCACAAA TTCACTTGTC CGTAACCAGT TTGACCGATA
ATGGCAGGGC TTGAATGTTC ATGCAACTAC CCACTTGCAC AATATGGATA GTAGGAGTAC AAAAGGTAAT TTACCATCCC
ATCACAAATC ATAGGGATGA TTTTAATGGA AGGTTCTACT TTCTGTTTAG CTTGCACATG TTCTATCACA TATACTGGTA
GTTATGCATC TGTAATTCTA TTCCACATTC AATGGAAGTC TCTTTCTGTT TAGAATGCTT AATGAACCAA TAGAGATGAA
AGTATTGAGA TCATGAGTTG TGCTTAAAGT GCAACAGCAA GCTACATGGA ACCGCAGCAC TCAAGTTGCT CATTAATTGT
ACTATAAGCA ACAAAAGTCG CAATCAAGTT GCCTTTGTTC CTTCAATCAT TTTTTTCCCT GCATGCAAGT TTGTATGTCA
GATACAATTT TGTAAAGGAA AAGCAGTGAG TTCCATTCTT ATACCAAGGT ATTCTCACTC ATGTGTATTG TATTTGACAA
AATACAAATT TAGAACCTAT CATGATCTTT CTCGTTAATC TATACAAAAG ATCAACTGAT CAATACTTGC AACTGTTTCC
CACAACGACA GGGCCTTTGG CTTTGGACGG ACAAGAGCTG ACATGGAACC ATCCTCACAG CCTCAGCCTG TGATGGGTGT
TGCCACTGGT GGGTCACAAG CATATCCTCC TCCTGCTGCT GCATATCCAC CTCAAGCCAT GGTTCCTGGA GCTCCTGCTG
TTGTTCCTCC TGGCTCACAG CCATCAGCAC CATTCCCCAC TAATCCAGCT CAACTCAGTG CTCAGCACCA GCTAGTCTAC
CAACAAGCCC AGCAATTTCA TCAGCAGCTG CAGCAACAGC AACAGCAGCA ACTCCGTGAG TTCTGGGCTA ACCAAATGGA
AGAGATTGAG CAAACAACCG ACTTCAAGAA CCACAGCTTG CCACTCGCAA GGATAAAGAA GATAATGAAG GCTGATGAGG
ATGTCCGGAT GATCTCGGCA GAAGCCCCCG TTGTCTTCGC AAAGGCATGC GAGGTATTCA TATTAGAGTT AACATTGAGG
TCGTGGATGC ACACGGAGGA GAACAAGCGC CGGACCTTGC AGAAGAATGA CATTGCAGCT GCCATCACCA GGACTGATAT
CTATGACTTC TTGGTGGACA TAGTTCCCAG GGATGAAATG AAAGAAGAAG GGCTTGGGCT TCCGAGGGTT GGCCTACCGC
CTAATGTGGG GGGCGCAGCA GACACATATC CATATTACTA CGTGCCAGCG CAGCAGGGGC CTGGATCAGG AATGATGTAC
GGTGGACAGC AAGGTCACCC GGTGACGTAT GTGTGGCAGC AGCCTCAAGA GCAACAGGAA GAGGCCCCTG AAGAGCAGCA
CTCTCTGCCA GAAAGTAGCT AAAGATGATA CAGTGAAGTT GTGACATTGA TATACATTGT CCTGTGAACT TAGGGCCTCT
AAAACTCAGT GCTCTTGTCA AAACTATTCC CATGATTGTT GGCTGAAACG GGTAATCTGA TTAGGTCTTA GGCTTTCCTA
ATGTTAGTTC TGCTCTGCTA TGGCAGCAGT AGAAAAAAAA AAGATTGTGA TTTGGTAGGT GATTTGCAAC TAATGTAGTA
ACTGTACCTT ACCTTTCATC AGTTTCTAAT CCAATACTCA AAAGTGCTGG C