Os02t0182100-01

Locus

Os02g0182100

Description

B-type response regulator, Cytokinin signaling, Rice meiosis and fertility

RAP-DB Gene Symbol Synonym(s)

RR24, OsRR24, Rrb2, Orr4, OsRR17, OsRRB2, DLC1

RAP-DB Gene Name Synonym(s)

B-TYPE RESPONSE REGULATOR 4, B-type response regulator 4, B-type RR 2, Defective Leptotene Chromosome 1

CGSNL Gene Symbol

DLC1

CGSNL Gene Name

DEFECTIVE LEPTOTENE CHROMOSOME 1

Oryzabase Gene Symbol Synonym(s)

RR24, OsRR24, Rrb2, Orr4, OsRR17, OsRRB2, OsRR24/LEPTO1, OsLEPTO1, LEPTO1, OsDLC1

Oryzabase Gene Name Synonym(s)

B-type response regulator 4, B-type RR 2, LEPTOTENE1, LEPTOTENE 1, Defective Leptotene Chromosome 1

Transcript Evidence

AK100530 (Genbank)

BR000253 (Genbank)

Protein Evidence

Q6H805 (UniProt)

Literature

PMID: 16919402

PMID: 17293362

PMID: 31004552

Note

Manual Curation

July 31, 2019

Gene Ontology (GO)

Biological Process: two-component signal transduction system (phosphorelay) (GO:0000160)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: two-component response regulator activity (GO:0000156)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

Signal transduction response regulator, receiver domain (IPR001789)

Myb-like DNA-binding domain, SHAQKYF class (IPR006447)

Homeodomain-like (IPR009057)

CheY-like superfamily (IPR011006)

Homeodomain-related (IPR012287)

Myb, DNA-binding (IPR014778)

Response regulator, plant B-type (IPR017053)

Transcription regulator HTH, Myb-type, DNA-binding (IPR017930)

Full-length cDNA

J023101H04 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0182100-01)

RiceXPro (AK100530)

Others

Oryzabase (8151)

KEGG (Os02t0182100-01)

Transcript

2354 bp

>Os02t0182100-01 B-type response regulator, Cytokinin signaling, Rice meiosis and fertility
TTTGGTGGTGGTGCTCGCTCTCGCTCACCCTGCTTTGACCTTTGGATTTTTATTTTTAAG
GATCCAAGAAAGTGCTGTTTCTTGGGTTGCTTGGAGGTGGAGGAGTTTGGGAGATTGTTT
GTGTTTGATTGATTGGTTGATTGATTGGAGGAAGATGACGGTGGAGGAGAGGCAGGGGAG
GGTGGGAGGCCATGGTGTGAGCGGCGGCGGCGGCGGGAGAGACCAGTTCCCGGTCGGCAT
GCGGGTGCTCGCCGTCGACGACGACCCCACCTGCCTCAAGATCCTCGAGAACCTCCTGCT
TCGATGCCAGTATCACGTGACAACAACTGGTCAGGCGGCCACGGCCCTGAAGCTGCTCAG
GGAGAACAAGGACCAGTTTGACCTGGTGATCAGCGACGTCCACATGCCGGACATGGATGG
CTTCAAACTCCTTGAGCTTGTCGGCCTCGAGATGGACCTCCCAGTCATTATGTTGTCTGC
GAACGGGGAAACACAAACTGTCATGAAGGGTATAACCCATGGTGCATGTGACTATCTTCT
GAAGCCAGTGCGTCTTGAGCAGCTAAGGACGATATGGCAACATGTGATTAGGCGTAAGAA
TTGTGATGCTAAGAACCGTGGTAACGATGATGACGCTGGTCAGAAGGCACAGGGAATGAA
CAATGAAGGTGAGAGTATTGGTGCTAACCGCAACAAGAGGCAGTCACGGAAAAGTAGAGA
TGAGAATGGAGATGATGGTGATGATTCTGATGAGAACAGTAATGAGAATGGAGACTCATC
AACACAGAAGAAGCCAAGGGTCGTGTGGTCTGTTGAGCTGCACCGAAAGTTTGTGGCTGC
TGTTAACCAGCTTGGCATCGAGAAGGCTGTTCCAAAGAAAATATTGGATCTCATGAATGT
AGAGAACATCACCAGGGAGAATGTTGCTAGTCATTTGCAGAAGTATCGGCTGTACCTTAA
ACGGTTGAGCACTGATGCAAGCAGGCAGGCTAACCTTGCAGCTGCATTTGGAGGAAGGAA
CCCTGCTTACATAAACATGAATTCATTTGGAAACTACAACGCATATGGTAGATACCGTAC
AGTCCCAACTGCTGGCCATACCCAGGCAAACAACATTCTTACTAGGATGAACTCCCCTTC
TGCGTTTGGTGTTCATGGTTTGCTGCATTCACAGCCAATTCAGTTAGGACATGCCCAAAA
TAATCTGAGCACTTCACTGAATGATTTAGGAGGGCTTAATAATGGTAACATGATCAGAGG
TGCACAGATGTCAACAATTCTAACTGGTCCTTCTGGTAACTCCTTTCCAAACATATCGAA
TGGTGCACCGCTGGCAACTGCAAACAGATCACTGCAACCTCTTGAGTCGAGCAATCAGCA
ACACCTTAGTCGGGTGCATTCATCTTCTGCAGATCCATTTAGCACACTTGTTGGTGAGTC
TCCCCAGTTTCCTGATCTTGGAAGAACCACCAATACTTGGCAAACTGCGGTTCCATCCAA
CATTCAGGATCGTGGTCACAATGATAACATGTCGCAAGCCACCCTGCATATGAATGGCCC
CAAAATTGAACCTGTCTCAAGCTTCACATCATCCAATCAGATTCCGCTGCTGGGAAATGA
GATGCAGGGCCAAGTAGCATCACTAGCTAGCAATGTTCCAATAGCATTCAATCAGGACAC
ATCACCATTCAACTATGGAAGCAGCACAAACTCAAGAGACATGCTAAATAACAGCCATGT
ATTTAGTAACTCCAGCATCAACACATCGTTGCCCAACCTTAGCTTAGACAATCCGGCTGT
ACCAAGGCAGACACTGGATCGTGGGAATACGGGCATTGTTTCTCCCATGCAAGATGGAAG
GATTCATCACCAAGCTGTTAGCAATCAGCTAAACTATAATGACGATCTTATGCGGACAAC
TGGGCTGCAAAGGGGTCTCAGTGGTGGTCTAGATGACATTGTTGTTGACATGTTTAGGCC
GGACCGCGAAGACGACGGCGTTCCTTACATCGATGGGGACTGGGAGCTGGTCTAGCCAGC
CTCCATTTCAATCATTAGTCCGCGTACGAGGTTTTTCTGCATTCGCGGTGTCGGCTGCTG
ATTGGTCCATGCTCACTTGTCAGCACAAAGTGGTGTTCATAGTGGCTAGCCTTCATCACA
AGTGCATTTCACATTTGGCTTCTTTTTTCAGCTTAGTGATTATTAGTTGGCCAGTCAGTC
TGTGAAATTTATGTGGAGAAACGGCTATGTGGTGTGTTTTTATCATGACTTATACTATAA
TAACTATGTTAGTTCAGGTATAACCGGTTATCCTGATAATATAGTATGCTTGGTAAAATT
CTCGTTAATCATCG

CDS

1881 bp

>Os02t0182100-01 B-type response regulator, Cytokinin signaling, Rice meiosis and fertility
ATGACGGTGGAGGAGAGGCAGGGGAGGGTGGGAGGCCATGGTGTGAGCGGCGGCGGCGGC
GGGAGAGACCAGTTCCCGGTCGGCATGCGGGTGCTCGCCGTCGACGACGACCCCACCTGC
CTCAAGATCCTCGAGAACCTCCTGCTTCGATGCCAGTATCACGTGACAACAACTGGTCAG
GCGGCCACGGCCCTGAAGCTGCTCAGGGAGAACAAGGACCAGTTTGACCTGGTGATCAGC
GACGTCCACATGCCGGACATGGATGGCTTCAAACTCCTTGAGCTTGTCGGCCTCGAGATG
GACCTCCCAGTCATTATGTTGTCTGCGAACGGGGAAACACAAACTGTCATGAAGGGTATA
ACCCATGGTGCATGTGACTATCTTCTGAAGCCAGTGCGTCTTGAGCAGCTAAGGACGATA
TGGCAACATGTGATTAGGCGTAAGAATTGTGATGCTAAGAACCGTGGTAACGATGATGAC
GCTGGTCAGAAGGCACAGGGAATGAACAATGAAGGTGAGAGTATTGGTGCTAACCGCAAC
AAGAGGCAGTCACGGAAAAGTAGAGATGAGAATGGAGATGATGGTGATGATTCTGATGAG
AACAGTAATGAGAATGGAGACTCATCAACACAGAAGAAGCCAAGGGTCGTGTGGTCTGTT
GAGCTGCACCGAAAGTTTGTGGCTGCTGTTAACCAGCTTGGCATCGAGAAGGCTGTTCCA
AAGAAAATATTGGATCTCATGAATGTAGAGAACATCACCAGGGAGAATGTTGCTAGTCAT
TTGCAGAAGTATCGGCTGTACCTTAAACGGTTGAGCACTGATGCAAGCAGGCAGGCTAAC
CTTGCAGCTGCATTTGGAGGAAGGAACCCTGCTTACATAAACATGAATTCATTTGGAAAC
TACAACGCATATGGTAGATACCGTACAGTCCCAACTGCTGGCCATACCCAGGCAAACAAC
ATTCTTACTAGGATGAACTCCCCTTCTGCGTTTGGTGTTCATGGTTTGCTGCATTCACAG
CCAATTCAGTTAGGACATGCCCAAAATAATCTGAGCACTTCACTGAATGATTTAGGAGGG
CTTAATAATGGTAACATGATCAGAGGTGCACAGATGTCAACAATTCTAACTGGTCCTTCT
GGTAACTCCTTTCCAAACATATCGAATGGTGCACCGCTGGCAACTGCAAACAGATCACTG
CAACCTCTTGAGTCGAGCAATCAGCAACACCTTAGTCGGGTGCATTCATCTTCTGCAGAT
CCATTTAGCACACTTGTTGGTGAGTCTCCCCAGTTTCCTGATCTTGGAAGAACCACCAAT
ACTTGGCAAACTGCGGTTCCATCCAACATTCAGGATCGTGGTCACAATGATAACATGTCG
CAAGCCACCCTGCATATGAATGGCCCCAAAATTGAACCTGTCTCAAGCTTCACATCATCC
AATCAGATTCCGCTGCTGGGAAATGAGATGCAGGGCCAAGTAGCATCACTAGCTAGCAAT
GTTCCAATAGCATTCAATCAGGACACATCACCATTCAACTATGGAAGCAGCACAAACTCA
AGAGACATGCTAAATAACAGCCATGTATTTAGTAACTCCAGCATCAACACATCGTTGCCC
AACCTTAGCTTAGACAATCCGGCTGTACCAAGGCAGACACTGGATCGTGGGAATACGGGC
ATTGTTTCTCCCATGCAAGATGGAAGGATTCATCACCAAGCTGTTAGCAATCAGCTAAAC
TATAATGACGATCTTATGCGGACAACTGGGCTGCAAAGGGGTCTCAGTGGTGGTCTAGAT
GACATTGTTGTTGACATGTTTAGGCCGGACCGCGAAGACGACGGCGTTCCTTACATCGAT
GGGGACTGGGAGCTGGTCTAG

Protein

627 aa

>Os02t0182100-01 B-type response regulator, Cytokinin signaling, Rice meiosis and fertility
MTVEERQGRVGGHGVSGGGGGRDQFPVGMRVLAVDDDPTCLKILENLLLRCQYHVTTTGQ
AATALKLLRENKDQFDLVISDVHMPDMDGFKLLELVGLEMDLPVIMLSANGETQTVMKGI
THGACDYLLKPVRLEQLRTIWQHVIRRKNCDAKNRGNDDDAGQKAQGMNNEGESIGANRN
KRQSRKSRDENGDDGDDSDENSNENGDSSTQKKPRVVWSVELHRKFVAAVNQLGIEKAVP
KKILDLMNVENITRENVASHLQKYRLYLKRLSTDASRQANLAAAFGGRNPAYINMNSFGN
YNAYGRYRTVPTAGHTQANNILTRMNSPSAFGVHGLLHSQPIQLGHAQNNLSTSLNDLGG
LNNGNMIRGAQMSTILTGPSGNSFPNISNGAPLATANRSLQPLESSNQQHLSRVHSSSAD
PFSTLVGESPQFPDLGRTTNTWQTAVPSNIQDRGHNDNMSQATLHMNGPKIEPVSSFTSS
NQIPLLGNEMQGQVASLASNVPIAFNQDTSPFNYGSSTNSRDMLNNSHVFSNSSINTSLP
NLSLDNPAVPRQTLDRGNTGIVSPMQDGRIHHQAVSNQLNYNDDLMRTTGLQRGLSGGLD
DIVVDMFRPDREDDGVPYIDGDWELV*

5'UTR

chr02:4578104..4578257 (- strand) : 154 bp

CDS

chr02:4577941..4578103 (- strand) : 163 bp

chr02:4577233..4577385 (- strand) : 153 bp

chr02:4576268..4576660 (- strand) : 393 bp

chr02:4576091..4576167 (- strand) : 77 bp

chr02:4574656..4575696 (- strand) : 1041 bp

chr02:4574150..4574203 (- strand) : 54 bp

3'UTR

chr02:4573831..4574149 (- strand) : 319 bp

FASTA

>Os02t0182100-01 class=Sequence position=chr02:4573831..4578257 (- strand)
TTTGGTGGTG GTGCTCGCTC TCGCTCACCC TGCTTTGACC TTTGGATTTT TATTTTTAAG GATCCAAGAA AGTGCTGTTT
CTTGGGTTGC TTGGAGGTGG AGGAGTTTGG GAGATTGTTT GTGTTTGATT GATTGGTTGA TTGATTGGAG GAAGATGACG
GTGGAGGAGA GGCAGGGGAG GGTGGGAGGC CATGGTGTGA GCGGCGGCGG CGGCGGGAGA GACCAGTTCC CGGTCGGCAT
GCGGGTGCTC GCCGTCGACG ACGACCCCAC CTGCCTCAAG ATCCTCGAGA ACCTCCTGCT TCGATGCCAG TATCACGGTA
TGCTGCTAAT CTGCAATCTC TCTCTCTCTC GAGCTCGAGC GAGCGAGCGA GCGAGTTCTC TCCATGGTTG TGGATTGAGC
TTGTGCTGTA TCGATCAATT TTTTTTTCGT TTTGGTTTAG TACTGTTCTA TAGTTGTTTT TTTTCTCTCT CTCTCTTGGA
TTTAATTTTT GTTTTTTTTG GTGATGCGCT AGTTCTTCTT TGCTTGGCTT TCACAGTTTC ACTCGTAGAT GTTTCTGTTG
TTCTTGGTGG TCTATTTCTT CGGCCATGTA ATGTCAACTC AAGAACGGGT TTTGCCCCTT TCCTCTTAAA AAAAGTTTTT
TTCCCCTCTC TTTTCTTCGA TATAATTTCA ACCCTTCTGT CTGAATCTCC AATCCTTTCT ACTGTTCTTT GGGTTGCACA
CATGGTGGTT GTGTAAGGAT TATCTTCTGC TGACCTTTTT TCCTTGTTGC AGCAAAATAG TAGTAGTACT AATTCTTTTG
ATAATTTTGA CTTGCCTATG TATTGTGTTG TTGAATCTGG CCTGATTGGA TTTGATGTGG TGTGATTTGC AGTGACAACA
ACTGGTCAGG CGGCCACGGC CCTGAAGCTG CTCAGGGAGA ACAAGGACCA GTTTGACCTG GTGATCAGCG ACGTCCACAT
GCCGGACATG GATGGCTTCA AACTCCTTGA GCTTGTCGGC CTCGAGATGG ACCTCCCAGT CATTAGTAAG TCATGCTTTG
CTTGATCTGA TGTGTCATTC TTGTAACCAG AGATAGTATG TTCTAGTAAG ATGCGTGTGG ATTGCATGAG ATCTAGACAT
CTAGTGAGTG ATTTTACTTC ATTTGAACTG CTTGGGTTGC AGATACATGA TTATTTATAG CAATAAGGTA GTTAGCTGAA
AATGGCAACA AGTGTGAGAC ATGGAAAACT CATGAAATTT CTTGGTTCAA ATCTATTTTT GGAAAGCTCC TTTCTGTTTT
ACTGTTGGTT TGGTGCGTAG GTCAGGTAAC CGATGAAAGT TTCCTAATGC GAAAATTTGG TAGATACCGT CACGTTTGCT
CTTGTTAGTT ACCCTGATTG CCTTGCACAA ATGACTATGA TGCTGTATCC TCTTACTTCT CAGCCAGTTT TTTTTTTTTT
TTTTTACATT TATTTGGAAC GTTCTCCTGC AAACTGACTG AGAAACATCA GGTCGACCAA CGATGTTTGC GTTTATGTTA
ACGCGGATCT AATAACATTA CTTTGACTGC ATTCATGAAC CTTACCTTAC ATTCTGAATT GACTATCTGT CATGTAGTGT
TGTCTGCGAA CGGGGAAACA CAAACTGTCA TGAAGGGTAT AACCCATGGT GCATGTGACT ATCTTCTGAA GCCAGTGCGT
CTTGAGCAGC TAAGGACGAT ATGGCAACAT GTGATTAGGC GTAAGAATTG TGATGCTAAG AACCGTGGTA ACGATGATGA
CGCTGGTCAG AAGGCACAGG GAATGAACAA TGAAGGTGAG AGTATTGGTG CTAACCGCAA CAAGAGGCAG TCACGGAAAA
GTAGAGATGA GAATGGAGAT GATGGTGATG ATTCTGATGA GAACAGTAAT GAGAATGGAG ACTCATCAAC ACAGAAGAAG
CCAAGGGTCG TGTGGTCTGT TGAGCTGCAC CGAAAGTTTG TGGCTGCTGT TAACCAGCTT GGCATCGAGA GTAAGATAAT
TTCTCACAAC CTAGCTACTG AGAATATTGG CTGGCTATTT TTCTTAGTTC AATGTCATAT GTGTTAATAT TTGTATGCTT
GTTTTTTCAG AGGCTGTTCC AAAGAAAATA TTGGATCTCA TGAATGTAGA GAACATCACC AGGGAGAATG TTGCTAGTCA
TTTGCAGGTC GAATTTCTTT CCTTATCTTT GACCGTTCAT TTCATCATGT TGTTTACTAT GGTTTATCAC TGCACCAAAT
TATTGTTATT ATTGTCCCAG ATATCTGAAA GAGGATTTTT TTTAATATAT GATAATACAG CCCTAAAATA TTCCTAATTC
ATATTGTTGC ATGTTCTGTA TTTTGTTGAG TTCTTTTTCA GTATTTGTAC GAGAAGCAAA ATATAACATT TATGTTCTCA
TACCATTTTC CTAGTATATT GATTGTGCAA TCGTAAGTAC TAATTCACCA GTGTTAAATT CAGAGTTTTG CTAACCTATT
CATTTCTTAG CTATTTTTTT TCCTCTTGTT TGCACCTACA AGTATACTTC ACTGATGTTT CTTCTCTGCT TGTCATTTCA
GAAGTATCGG CTGTACCTTA AACGGTTGAG CACTGATGCA AGCAGGCAGG CTAACCTTGC AGCTGCATTT GGAGGAAGGA
ACCCTGCTTA CATAAACATG AATTCATTTG GAAACTACAA CGCATATGGT AGATACCGTA CAGTCCCAAC TGCTGGCCAT
ACCCAGGCAA ACAACATTCT TACTAGGATG AACTCCCCTT CTGCGTTTGG TGTTCATGGT TTGCTGCATT CACAGCCAAT
TCAGTTAGGA CATGCCCAAA ATAATCTGAG CACTTCACTG AATGATTTAG GAGGGCTTAA TAATGGTAAC ATGATCAGAG
GTGCACAGAT GTCAACAATT CTAACTGGTC CTTCTGGTAA CTCCTTTCCA AACATATCGA ATGGTGCACC GCTGGCAACT
GCAAACAGAT CACTGCAACC TCTTGAGTCG AGCAATCAGC AACACCTTAG TCGGGTGCAT TCATCTTCTG CAGATCCATT
TAGCACACTT GTTGGTGAGT CTCCCCAGTT TCCTGATCTT GGAAGAACCA CCAATACTTG GCAAACTGCG GTTCCATCCA
ACATTCAGGA TCGTGGTCAC AATGATAACA TGTCGCAAGC CACCCTGCAT ATGAATGGCC CCAAAATTGA ACCTGTCTCA
AGCTTCACAT CATCCAATCA GATTCCGCTG CTGGGAAATG AGATGCAGGG CCAAGTAGCA TCACTAGCTA GCAATGTTCC
AATAGCATTC AATCAGGACA CATCACCATT CAACTATGGA AGCAGCACAA ACTCAAGAGA CATGCTAAAT AACAGCCATG
TATTTAGTAA CTCCAGCATC AACACATCGT TGCCCAACCT TAGCTTAGAC AATCCGGCTG TACCAAGGCA GACACTGGAT
CGTGGGAATA CGGGCATTGT TTCTCCCATG CAAGATGGAA GGATTCATCA CCAAGCTGTT AGCAATCAGC TAAACTATAA
TGACGATCTT ATGCGGACAA CTGGGCTGCA AAGGGGTCTC AGTGGTGGTC TAGATGACAT TGTTGTTGAC ATGTTTAGGC
CGGTATGATT CTTTCTTGTA TTTATTTTTT AGAAGAGTAT TCTATATTGG TATTCTGTTT CAGAATTCTA TTGCTTTGTG
TTGTTCAAGC AGATCAGTCT TTAGTGACCT ATGAAAATTT CTGGACACAG TAGTAGTCTA TCAAACACTC ACTTTTCTAT
GGATGTGCGT TACTCATCTC TATTCATATG TAGTCCACAA GCATGTTCAT GTTTGATTCC TTCAAGATAT TTTCTGCTGC
ATAGTACCAC CTTTAATCCT TTGCAGTCTG CACTATATTA TTATAGTATG AAACAGCAAC ATATGTATTG AAATATTTCA
TATTCGTTCT GAAGAGATTT CTAAGTTTAG TTTCAGTACC ACATATTTCT TAATCAATAT GTTAACTGCC ATGCTGGGAA
GTACAAACAA TGAGTATACT ATGTATCTGA CAACGCCATC TTTCATCGAT GCAGGACCGC GAAGACGACG GCGTTCCTTA
CATCGATGGG GACTGGGAGC TGGTCTAGCC AGCCTCCATT TCAATCATTA GTCCGCGTAC GAGGTTTTTC TGCATTCGCG
GTGTCGGCTG CTGATTGGTC CATGCTCACT TGTCAGCACA AAGTGGTGTT CATAGTGGCT AGCCTTCATC ACAAGTGCAT
TTCACATTTG GCTTCTTTTT TCAGCTTAGT GATTATTAGT TGGCCAGTCA GTCTGTGAAA TTTATGTGGA GAAACGGCTA
TGTGGTGTGT TTTTATCATG ACTTATACTA TAATAACTAT GTTAGTTCAG GTATAACCGG TTATCCTGAT AATATAGTAT
GCTTGGTAAA ATTCTCGTTA ATCATCG

Locus: Os02g0182100

Loading...

Locus: Os02g0182100

Loading...