Os02t0182800-01

Locus

Os02g0182800

Description

Similar to NTH23 protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

HOS58

CGSNL Gene Name

HOMEOBOX ORYZA SATIVA 58

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Homeobox protein knotted-1-like 2, Homeobox protein HOS58

Transcript Evidence

AK243352 (DDBJ, Best hit)

Protein Evidence

Q0E3C3 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Cellular Component: nucleus (GO:0005634)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: sequence-specific DNA binding transcription factor activity (GO:0003700)

Molecular Function: protein binding (GO:0005515)

Molecular Function: sequence-specific DNA binding (GO:0043565)

Functional domain (InterPro)

Homeobox (IPR001356)

ELK (IPR005539)

KNOX1 (IPR005540)

KNOX2 (IPR005541)

Homeobox KN domain (IPR008422)

Homeodomain-like (IPR009057)

Homeodomain-related (IPR012287)

Full-length cDNA

J100060L07 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0182800-01)

Others

Oryzabase (8706)

KEGG (Os02t0182800-01)

Transcript

1428 bp

>Os02t0182800-01 Similar to NTH23 protein.
GTCATCCGCTCTTCTTCCCCTCTTCCCCACTCGCACCAACCCCAACCCCCCCAACCGCCG
CCGCCGCCGCCGACGACCCACCGGTCGCCGCGTCGCCGGAGTCGCGTACTGGAGAGGGGG
GCGGAGAGGCACCAGCCGCCCCATGGCGTTCCACTACCCGGACCACGGCCTCGCCATGGA
CCCGTCCTCCGCCGCGGCGTCGTCGCCCAACCCTAGCTTCTCCCCCGGAGGCGGGGGCGG
GGGCGGGGTCGGGGGAGGGGAGAGGGAGAAGGCGGCCGTCGCGGCGCACCCGCTCTACGA
GCGCCTGCTCGAGGCGCACGTCGCCTGCCTCCGCGTCGCCACCCCCGTGGACCAGCTCCC
CCGCATCGACGCGCAGATCGCCGCGCGCCCGCCTCCCCTCGCAGCCGCCTCCGCCGCCGC
CGCCGCCGGTGGCCCCTCCGGTGGCGAGGAGCTCGACCTCTTCATGACACATTATGTGTT
GCTTCTTTGCTCATTCAAGGAACAACTTCAGCAGCATGTGCGTGTTCATGCAATGGAAGC
AGTGATGGGGTGCTGGGAACTTGAACAGTCTTTACAAAGTCTAACAGGGGCATCTCCTGG
TGAAGGGACTGGAGCGACTATGTCTGATGATGAAGATAACCAAGTGGACAGTGAAGCCAA
CATGTTTGATGGAAATGATGGGTCAGACGGCATGGGCTTTGGTCCCTTAATGCTGACCGA
GGGTGAAAGATCCTTGGTTGAGCGTGTACGGCATGAGCTGAAGAACGAGCTTAAGCAGGG
GTACAAAGAAAAGCTTGTGGATATTAGGGAAGAGATCCTTCGCAAGCGGAGAGCTGGTAA
ACTTCCTGGTGATACTGCATCTATACTAAAAGCTTGGTGGCAAGCTCATTCTAAGTGGCC
ATACCCAACTGAAGACGACAAGGCCCGCCTGGTGCAGGAAACGGGGTTACAACTGAAGCA
AATCAACAATTGGTTCATTAACCAACGCAAACGAAACTGGCATAGCAACCCAGCATCCTC
TGGTGAAAAGACCAAGAAGAAAAGAAACGTTACAGGTGATGGTGGTGCTGAGCAATCGTG
GTAGATTGGTTCAACATGAAACTAGATGTAAACAGTACCTTTTATTGTGAAGAGTGTAGT
ACATTCTCTCGTGCTCTGGTGTGACAAAATCTGGAGACCGGCCCATTCACAAGGGAATTG
CGATCATAGGCGTAATCACTGGGCAAAGAAGTCATCTGAAATTGTAGCATAAGCGCACAA
AACTGAGGTGGGTGGTATTTGACTTTCGCAGTATAGCATCGACTGTCTGCTAATGTGATT
TTGTGAAGGAATGTTCTGTATAACCGATGAACGGAAGGAAGAATTGTATTGTGTATGTAA
TTGTGTATCTTATTTATCATGTAATATATATATGATATTAGGAGCTTT

CDS

942 bp

>Os02t0182800-01 Similar to NTH23 protein.
ATGGCGTTCCACTACCCGGACCACGGCCTCGCCATGGACCCGTCCTCCGCCGCGGCGTCG
TCGCCCAACCCTAGCTTCTCCCCCGGAGGCGGGGGCGGGGGCGGGGTCGGGGGAGGGGAG
AGGGAGAAGGCGGCCGTCGCGGCGCACCCGCTCTACGAGCGCCTGCTCGAGGCGCACGTC
GCCTGCCTCCGCGTCGCCACCCCCGTGGACCAGCTCCCCCGCATCGACGCGCAGATCGCC
GCGCGCCCGCCTCCCCTCGCAGCCGCCTCCGCCGCCGCCGCCGCCGGTGGCCCCTCCGGT
GGCGAGGAGCTCGACCTCTTCATGACACATTATGTGTTGCTTCTTTGCTCATTCAAGGAA
CAACTTCAGCAGCATGTGCGTGTTCATGCAATGGAAGCAGTGATGGGGTGCTGGGAACTT
GAACAGTCTTTACAAAGTCTAACAGGGGCATCTCCTGGTGAAGGGACTGGAGCGACTATG
TCTGATGATGAAGATAACCAAGTGGACAGTGAAGCCAACATGTTTGATGGAAATGATGGG
TCAGACGGCATGGGCTTTGGTCCCTTAATGCTGACCGAGGGTGAAAGATCCTTGGTTGAG
CGTGTACGGCATGAGCTGAAGAACGAGCTTAAGCAGGGGTACAAAGAAAAGCTTGTGGAT
ATTAGGGAAGAGATCCTTCGCAAGCGGAGAGCTGGTAAACTTCCTGGTGATACTGCATCT
ATACTAAAAGCTTGGTGGCAAGCTCATTCTAAGTGGCCATACCCAACTGAAGACGACAAG
GCCCGCCTGGTGCAGGAAACGGGGTTACAACTGAAGCAAATCAACAATTGGTTCATTAAC
CAACGCAAACGAAACTGGCATAGCAACCCAGCATCCTCTGGTGAAAAGACCAAGAAGAAA
AGAAACGTTACAGGTGATGGTGGTGCTGAGCAATCGTGGTAG

Protein

314 aa

>Os02t0182800-01 Similar to NTH23 protein.
MAFHYPDHGLAMDPSSAAASSPNPSFSPGGGGGGGVGGGEREKAAVAAHPLYERLLEAHV
ACLRVATPVDQLPRIDAQIAARPPPLAAASAAAAAGGPSGGEELDLFMTHYVLLLCSFKE
QLQQHVRVHAMEAVMGCWELEQSLQSLTGASPGEGTGATMSDDEDNQVDSEANMFDGNDG
SDGMGFGPLMLTEGERSLVERVRHELKNELKQGYKEKLVDIREEILRKRRAGKLPGDTAS
ILKAWWQAHSKWPYPTEDDKARLVQETGLQLKQINNWFINQRKRNWHSNPASSGEKTKKK
RNVTGDGGAEQSW*

5'UTR

chr02:4625425..4625566 (+ strand) : 142 bp

CDS

chr02:4625567..4625890 (+ strand) : 324 bp

chr02:4626827..4626947 (+ strand) : 121 bp

chr02:4627646..4627836 (+ strand) : 191 bp

chr02:4627913..4628044 (+ strand) : 132 bp

chr02:4628135..4628268 (+ strand) : 134 bp

chr02:4628367..4628406 (+ strand) : 40 bp

3'UTR

chr02:4628407..4628750 (+ strand) : 344 bp

FASTA

>Os02t0182800-01 class=Sequence position=chr02:4625425..4628750 (+ strand)
GTCATCCGCT CTTCTTCCCC TCTTCCCCAC TCGCACCAAC CCCAACCCCC CCAACCGCCG CCGCCGCCGC CGACGACCCA
CCGGTCGCCG CGTCGCCGGA GTCGCGTACT GGAGAGGGGG GCGGAGAGGC ACCAGCCGCC CCATGGCGTT CCACTACCCG
GACCACGGCC TCGCCATGGA CCCGTCCTCC GCCGCGGCGT CGTCGCCCAA CCCTAGCTTC TCCCCCGGAG GCGGGGGCGG
GGGCGGGGTC GGGGGAGGGG AGAGGGAGAA GGCGGCCGTC GCGGCGCACC CGCTCTACGA GCGCCTGCTC GAGGCGCACG
TCGCCTGCCT CCGCGTCGCC ACCCCCGTGG ACCAGCTCCC CCGCATCGAC GCGCAGATCG CCGCGCGCCC GCCTCCCCTC
GCAGCCGCCT CCGCCGCCGC CGCCGCCGGT GGCCCCTCCG GTGGCGAGGA GCTCGACCTC TTCATGGTAC GCCTCTCCGC
TCCCAGGCCC CTCCTTATGC CCCTTTCCGC GTGCAGAATT TTCTGCTGCA GGTCGGGGAA ACGGCGATGG GAGGAAAAGA
AATGGACAAT TAAGTTTGTT TGGATTATCT GCAATAAGAT TTTTCAATTG CTTTGCTATT GTATGGACTT TATATGGTAG
TAGTAGTAGT AAGTTTGCAC GTTTCCCCTA TGCTTATGAT TGGTTGTCAT CCAAATTGGA CAAAAAATCT CAGGATAAAG
TTCAAACAGT CTCACTATAC CTTGAAAATC ACCACAAGGG TGAACTTGTA CTATGGTTAT TTTGTTGCAA AGCCCGTTTT
GTTGTTGTAG ATGACTTTGA TATGCCACTG ATGTCTTAGT GACATCCTTA TAGTGAGTGG CACGTAGTGG AGATAGTTGA
AACTTAGTGG CATATTGTGG ATTTGTCCTA GTGATTATGA AGTTGTTACA AGAATTGTTT GCTTGAAAGG ATTCTATCAC
CCGTTGATAA TTATTGCTAC TCCCGCATCC ATTGATACCT TCTAAACGGG ACACAGTCAT ATAAATAAGA AATAAATCCA
CAAATTCAAA GGCTCATAAA TCTAGACCAA AAGCTATCAA AGTGGAAAAA TAGCTGAGGC CCATTTCTCT AGTTTCTGAG
ATGATGTAAA ACCTTGCATG AATGAAAGTT CCCTGCCAAG ATTATTGATT TGCTATTAAT ATCTGTGCTA TGCTAATCTC
ATCTAATGAC AATACCTTGT TCTCATCATG CTGTTAACTG GAAAAATAAG CTCATGTATT GATGCCATTA CCTCTCTTTC
TACGAAATTT GCTGTGACGT TATGACCCCT GTGTTACTCC TTATCTTGGA AATGAACATG TCATTGTGTT TTTCACATGG
CAGCCCTTCT TGTGGACTCT AACATACTTC TCTTAATTGC AGACACATTA TGTGTTGCTT CTTTGCTCAT TCAAGGAACA
ACTTCAGCAG CATGTGCGTG TTCATGCAAT GGAAGCAGTG ATGGGGTGCT GGGAACTTGA ACAGTCTTTA CAAAGTCTAA
CAGGTAGACC AAAGCTTCTA TCTGCTTGAA TCAGTTCAGC AAATGGTAGA AAATTTCAAA CATACACTTT TTTTTTGTTA
TTTCATTGAT AATATTCAGG CAAGCAGATT GCTAATTTGC TATGAGTTAG TTTCAGTCCA ATTGCAATGG GAAACTACAT
AGTAGATCAA TTGAAACTAG AAAGGAAAAG AAGTATACAT AACATTTTCA ACACTATTCA TTTGAGACCA AGAATGTATG
TTCAATACCT TTTTAAATTT CAACCATCAC TTTGGTAATT ATTACTCTAT CAGAAAAAGG AGTTTTTGTT GTGCCCTACA
ATAAGCTTAG GATTAAGCAA ACTTAGATCT CAGAGACAAT CCGTGCCAAC TTGTCAGCAG CCATAAGCTA CCAACTATTA
CGTAAAATCT TAAATATGAT TTTGTTCATT TTCTGAGCTC TACTACACAT GCTGATATTG ATCAGAATCT CAAAGGCATG
TGTGAGGCCT TGGTAACAAT TCTGAGTTGA TCCAGGCTTG TAGATAACGC TGGGTAACTA CAATTGGAGT TGAGTTTGAT
AAGCTAGCTG TTCACCACTT TATATGGAGA ACATGCCCTT TTTTGTGCTC GGATTTGTAT CTTAAAGTCT GATACTTCTT
ACTGAAGGGG CCTAGATGAT GTTCGGACAA CTGAGTTATG CTTGTATGAT TGGTTCTGCA GGGGCATCTC CTGGTGAAGG
GACTGGAGCG ACTATGTCTG ATGATGAAGA TAACCAAGTG GACAGTGAAG CCAACATGTT TGATGGAAAT GATGGGTCAG
ACGGCATGGG CTTTGGTCCC TTAATGCTGA CCGAGGGTGA AAGATCCTTG GTTGAGCGTG TACGGCATGA GCTGAAGAAC
GAGCTTAAGC AGGTAGCCTT TTGTCCTTTG AAATGCTTCA TCCATCATCG TAGTGCATTA TTTGTGAACC AAAATGTCCT
GCCTGTAGGG GTACAAAGAA AAGCTTGTGG ATATTAGGGA AGAGATCCTT CGCAAGCGGA GAGCTGGTAA ACTTCCTGGT
GATACTGCAT CTATACTAAA AGCTTGGTGG CAAGCTCATT CTAAGTGGCC ATACCCAACT GTACGTGGCA CCAACATTCC
ATTTCCGTAA CTTTATTATT ATGGTATCAA TTGTGGGTCA TGACGAGCAA TTCTTTCTAC ACATATTCAG GAAGACGACA
AGGCCCGCCT GGTGCAGGAA ACGGGGTTAC AACTGAAGCA AATCAACAAT TGGTTCATTA ACCAACGCAA ACGAAACTGG
CATAGCAACC CAGCATCCTC TGGTGAAAAG ACCAAGAAGA AAAGGTAACT TATAGGAAAA TTATGCCTCA TTGTTCATTG
TTCCGTAACA AGCTCGCAAC ATTGTGTTTA TCAATTCTAC CCTGTTCATG CATGTAAAAA AGAAACGTTA CAGGTGATGG
TGGTGCTGAG CAATCGTGGT AGATTGGTTC AACATGAAAC TAGATGTAAA CAGTACCTTT TATTGTGAAG AGTGTAGTAC
ATTCTCTCGT GCTCTGGTGT GACAAAATCT GGAGACCGGC CCATTCACAA GGGAATTGCG ATCATAGGCG TAATCACTGG
GCAAAGAAGT CATCTGAAAT TGTAGCATAA GCGCACAAAA CTGAGGTGGG TGGTATTTGA CTTTCGCAGT ATAGCATCGA
CTGTCTGCTA ATGTGATTTT GTGAAGGAAT GTTCTGTATA ACCGATGAAC GGAAGGAAGA ATTGTATTGT GTATGTAATT
GTGTATCTTA TTTATCATGT AATATATATA TGATATTAGG AGCTTT

Locus: Os02g0182800

Loading...

Locus: Os02g0182800

Loading...