Os02t0193000-01

Locus

Os02g0193000

Description

Protein kinase-like domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsLysM-RLK1, OsLYK4, OsNFR5/OsRLK2, OsNFR5, NFR5, OsRLK2, RLK2

Oryzabase Gene Name Synonym(s)

LysM receptor-like kinase 1, LysM-type receptor-like kinase4, NFR5/NFP ortholog

Transcript Evidence

AK108910 (DDBJ, Best hit)

Protein Evidence

NP_001147941.1 (RefSeq)

Literature

Note

Manual Curation

Full-length cDNA

002-152-G07 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0193000-01)

RiceXPro (AK108910)

Others

Oryzabase (10920)

KEGG (Os02t0193000-01)

Transcript

1047 bp

>Os02t0193000-01 Protein kinase-like domain containing protein.
AATTACAAGGCCTCGCCGGAGACGGAGACGGAGACCAATCCGCCCCCGACCTCGCCGATG
GCGGAAACTCCACGCCGAATCCGCCGCGGCGGCGCCGGGCTCTCGCTCGTCGTCGTCGCC
CTCCTCCTCGCCGTCGCGGCGAGGGCGCAGCAGGAGTACGAGGCGAACCAGCAGAACGCC
TGCTACGCCACCAACGCGAGCTCCACCCTCGGCTACACCTGCAACGCCACCTCCGCCTCC
GCCGCCGCCGCGGCGCCCTGCGACGCGTACCTGGTGTTCCGCTCCTCCCCGCCCCTCTAC
GCCTCCGCTGTCTCCATCTCCTACCTCCTCAACGTCGCCGCCGCCGCCGTCGCCGACTCC
AACGCCGTCGACCCGGTCGCCCCCGTCGCCGCCGACCGCCTCGTGCTCGCGCCCGTGCCG
TGCGGCTGCTCCCCGGGCGGCTACTACCAGCACAACGCCTCCCACACCATCCGCGACACC
GGCGTCGAGACCTACTTCATCATCGCCAACCTCACCTACCAGGGCCTCTCGACGTGCCAG
GCTCTCATCGCGCAGAATCCCCTCCACGACAGCCGCGGCCTCGTCGCCGGCGACAACCTC
ACCGTCCCGCTCCGCTGCGCCTGCCCCTCGCCGCCGCAGGCCGCCGCGGGCGTCAAGCAC
ATGGTCACCTACCTCGTCACCTGGGGCGACACCGTCCGCGGCTTGGCGGCGACTACCCGC
TCGACCTGGCCATGGCCGTGGCGTCGCTGGCGGCGCGGTGCGTGGCGAGGCAGCCCGCCG
CGCGGCCGGCCATGGACGAGGTGTTCGTCTCGCTCGCGGCGGTGTACGGCTCCACGGTGG
ACTGGAACCCCTCGGATCACGGCAACTCCGGGTCGTCGCTGATTGGGAGGTAGCAAAACG
AACCAAATCGGTGGCAAATTCGATTCAAATCGATGCGAAAAGATCGGAATTTTTCAAATT
GAGTTTTGAATTTGTAGCTGAAAATAGTATTTGTGTTGCAATTGATGGTGCGAATAAAAA
CTGTCCTCGAGCAGCAGCGACAACTTG

CDS

891 bp

>Os02t0193000-01 Protein kinase-like domain containing protein.
TTACAAGGCCTCGCCGGAGACGGAGACGGAGACCAATCCGCCCCCGACCTCGCCGATGGC
GGAAACTCCACGCCGAATCCGCCGCGGCGGCGCCGGGCTCTCGCTCGTCGTCGTCGCCCT
CCTCCTCGCCGTCGCGGCGAGGGCGCAGCAGGAGTACGAGGCGAACCAGCAGAACGCCTG
CTACGCCACCAACGCGAGCTCCACCCTCGGCTACACCTGCAACGCCACCTCCGCCTCCGC
CGCCGCCGCGGCGCCCTGCGACGCGTACCTGGTGTTCCGCTCCTCCCCGCCCCTCTACGC
CTCCGCTGTCTCCATCTCCTACCTCCTCAACGTCGCCGCCGCCGCCGTCGCCGACTCCAA
CGCCGTCGACCCGGTCGCCCCCGTCGCCGCCGACCGCCTCGTGCTCGCGCCCGTGCCGTG
CGGCTGCTCCCCGGGCGGCTACTACCAGCACAACGCCTCCCACACCATCCGCGACACCGG
CGTCGAGACCTACTTCATCATCGCCAACCTCACCTACCAGGGCCTCTCGACGTGCCAGGC
TCTCATCGCGCAGAATCCCCTCCACGACAGCCGCGGCCTCGTCGCCGGCGACAACCTCAC
CGTCCCGCTCCGCTGCGCCTGCCCCTCGCCGCCGCAGGCCGCCGCGGGCGTCAAGCACAT
GGTCACCTACCTCGTCACCTGGGGCGACACCGTCCGCGGCTTGGCGGCGACTACCCGCTC
GACCTGGCCATGGCCGTGGCGTCGCTGGCGGCGCGGTGCGTGGCGAGGCAGCCCGCCGCG
CGGCCGGCCATGGACGAGGTGTTCGTCTCGCTCGCGGCGGTGTACGGCTCCACGGTGGAC
TGGAACCCCTCGGATCACGGCAACTCCGGGTCGTCGCTGATTGGGAGGTAG

Protein

297 aa

>Os02t0193000-01 Protein kinase-like domain containing protein.
LQGLAGDGDGDQSAPDLADGGNSTPNPPRRRRALARRRRPPPRRRGEGAAGVRGEPAERL
LRHQRELHPRLHLQRHLRLRRRRGALRRVPGVPLLPAPLRLRCLHLLPPQRRRRRRRRLQ
RRRPGRPRRRRPPRARARAVRLLPGRLLPAQRLPHHPRHRRRDLLHHRQPHLPGPLDVPG
SHRAESPPRQPRPRRRRQPHRPAPLRLPLAAAGRRGRQAHGHLPRHLGRHRPRLGGDYPL
DLAMAVASLAARCVARQPAARPAMDEVFVSLAAVYGSTVDWNPSDHGNSGSSLIGR*

5'UTR

chr02:5179724..5179725 (+ strand) : 2 bp

CDS

chr02:5179726..5180418 (+ strand) : 693 bp

chr02:5181653..5181850 (+ strand) : 198 bp

3'UTR

chr02:5181851..5182004 (+ strand) : 154 bp

FASTA

>Os02t0193000-01 class=Sequence position=chr02:5179724..5182004 (+ strand)
AATTACAAGG CCTCGCCGGA GACGGAGACG GAGACCAATC CGCCCCCGAC CTCGCCGATG GCGGAAACTC CACGCCGAAT
CCGCCGCGGC GGCGCCGGGC TCTCGCTCGT CGTCGTCGCC CTCCTCCTCG CCGTCGCGGC GAGGGCGCAG CAGGAGTACG
AGGCGAACCA GCAGAACGCC TGCTACGCCA CCAACGCGAG CTCCACCCTC GGCTACACCT GCAACGCCAC CTCCGCCTCC
GCCGCCGCCG CGGCGCCCTG CGACGCGTAC CTGGTGTTCC GCTCCTCCCC GCCCCTCTAC GCCTCCGCTG TCTCCATCTC
CTACCTCCTC AACGTCGCCG CCGCCGCCGT CGCCGACTCC AACGCCGTCG ACCCGGTCGC CCCCGTCGCC GCCGACCGCC
TCGTGCTCGC GCCCGTGCCG TGCGGCTGCT CCCCGGGCGG CTACTACCAG CACAACGCCT CCCACACCAT CCGCGACACC
GGCGTCGAGA CCTACTTCAT CATCGCCAAC CTCACCTACC AGGGCCTCTC GACGTGCCAG GCTCTCATCG CGCAGAATCC
CCTCCACGAC AGCCGCGGCC TCGTCGCCGG CGACAACCTC ACCGTCCCGC TCCGCTGCGC CTGCCCCTCG CCGCCGCAGG
CCGCCGCGGG CGTCAAGCAC ATGGTCACCT ACCTCGTCAC CTGGGGCGAC ACCGTCTCCG CCATCGCCGC GCGGTTCCGC
GTCGACGCGC AGGAGGTGCT CGACGCCAAC ACGCTCACCG AGAGCTCCAT CATATACCCC TTCACCACGC TGCTGGTCCC
GCTCAAGAAC GCGCCCACGC CGGACATGCT CGCGCCGCCG GCCCAGGCGC CGCCGCCCCC CGCGCCCGCG CCGCCGCGGG
CGCAGCCGCC GCCTGGTGGG TCGGGCAGCG GGAAGGGAGT CGCCGTTGGG GTAGGCGTCG GTTGCGGCGT TCTTGCGTTG
GCGGGTGTCT TTGGCTTGCT GTTCTTCTGT CTCCGGCGGC GACGCGGCGT TGGGGAAGAA AGTGTTCGTC CGGGGAAGGT
GGTCGGCGAC GTGTCCTCTT CGGCGGAGTA CGGCGCCCTG GCATCGGGGA AGCAGACGAC GACGGCAACc tcgatgtcgt
cgctgtccgc ggcgaggtcg ctgatggcga gcgaagtgcg cgaggcgttg gagtcgctaa cggtgtacaa gtactcggag
ctggagaagg ccacggcggg gttctcggag gagcggaggg tgcccggcac cgccgtgtac cgcggcgtgt tcaacggcga
tgcggcggcg gtgaagcgtg tttccggcga cgtgagcggc gaggtcggcA TCCTGAAGCG CGTGAACCAC TGCAGCCTGA
TCCGCCTCTC CGGCCTCTGC GTCCACCGCG GCGACACCTA CCTCGTCTTC GAGTACGCCG AGAACGGCGC GCTCAGCGAC
TGGCTCCACG GCGGCGACGC CGCCACCGGC GTCCTGGGGT GGAGGCAGCG CGTGCAGGTG GCGTTCGACG TCGCCGACGG
GCTCAACTAC CTCCACCACT ACACCAACCC GCCATGTgtg cacaagaaca tcaagagcag caacatcctc ctcgacgccg
acctccacgg caagatgtcc agcttcgggc tagcccgcgc gctccccgcg ggcgacggcg ccgccgccgc cgccgcgcag
ctgacgcgcc acgtcgtggg cacccagggc tacctctccc cggagtacct cgagcacggc ctcatcacgc ccaagctcga
cgtgttcgcc ttcggCGTCG TCCTCCTCGA GCTCCTCTCC GGCAAGGAGG CGGCGTCCTC CGGCGACGGC GAGAACGGCG
AGGCGCTGCT GCTGTGGGAG TCCGCGGCGG AGGCGCTCGT CGACGGCGGC GGCGAGGACG CGGGGAGCAA CGTGCGCGCG
TTCATGGACC CGCGGCTTGG CGGCGACTAC CCGCTCGACC TGGCCATGGC CGTGGCGTCG CTGGCGGCGC GGTGCGTGGC
GAGGCAGCCC GCCGCGCGGC CGGCCATGGA CGAGGTGTTC GTCTCGCTCG CGGCGGTGTA CGGCTCCACG GTGGACTGGA
ACCCCTCGGA TCACGGCAAC TCCGGGTCGT CGCTGATTGG GAGGTAGCAA AACGAACCAA ATCGGTGGCA AATTCGATTC
AAATCGATGC GAAAAGATCG GAATTTTTCA AATTGAGTTT TGAATTTGTA GCTGAAAATA GTATTTGTGT TGCAATTGAT
GGTGCGAATA AAAACTGTCC TCGAGCAGCA GCGACAACTT G

Locus: Os02g0193000

Loading...

Locus: Os02g0193000

Loading...