Os02t0202000-01

Locus

Os02g0202000

Description

Ethylene response factor, Transcription factor, Regulation of wax synthesis, Drought tolerance

RAP-DB Gene Symbol Synonym(s)

ERF3, Os02ERF, OsSHN1, OsWR1, WR1, OsERF#003, OsERF003, OsERF3, AP2/EREBP#012, AP2/EREBP12

RAP-DB Gene Name Synonym(s)

ETHYLENE RESPONSE FACTOR 3, ethylene response factor on chromosome 2, rice wax synthesis regulatory gene 1, wax synthesis regulator 1, Wax Synthesis Regulatory 1, ethylene response factor 3, APETALA2/ethylene-responsive element binding protein 12

CGSNL Gene Symbol

ERF3

CGSNL Gene Name

ETHYLENE RESPONSE FACTOR 3

Oryzabase Gene Symbol Synonym(s)

Os02ERF, OsSHN1, OsWR1, WR1, OsERF#003, OsERF003, OsERF3, AP2/EREBP#012, AP2/EREBP12

Oryzabase Gene Name Synonym(s)

ethylene response factor on chromosome 2, rice wax synthesis regulatory gene 1, wax synthesis regulator 1, Wax Synthesis Regulatory 1, ethylene response factor 3, APETALA2/ethylene-responsive element binding protein 12

Transcript Evidence

DQ468387

Protein Evidence

Q6Z786

Literature

PMID: 22130861

Note

Manual Curation

March 16, 2016

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-templated (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: transcription factor activity, sequence-specific DNA binding (GO:0003700)

Functional domain (InterPro)

AP2/ERF transcription factor ERF/PTI6 (IPR017392)

DNA-binding domain (IPR016177)

AP2/ERF domain (IPR001471)

Expression Databases

TENOR (Os02t0202000-00)

Others

Oryzabase (9402)

Transcript

791 bp

>Os02t0202000-01 Ethylene response factor, Transcription factor, Regulation of wax synthesis, Drought tolerance
GCCGCAGCAGTTTATATTCACTCAAACAAGTGCTTTCCTCCTCCCCCACACCTCCTCCGT
TCAGTTCAGAGGCGCCTAGCAATAGCAGCTCATTGCCTCATCTCTGCCTCCCCTGTCCTT
CTGGGGGCAGAGAATCTCTCCACTGCTGGAAAAATGGTACAGCCAAAGAAGAAGTTTCGT
GGAGTCAGGCAGCGGCACTGGGGCTCCTGGGTCTCTGAGATCAGACACCCCCTCCTTAAA
AGGAGGGTgtggctgggcacctttgagacggccgaggaggctgcgcgagcctacgatgag
gctgctgtgctgatgagtggccgcaacgccaagaccaacttcccCGTGCAGAGGAACTCC
ACCGGTGATCTCGCCACGGCCGCAGACCAGGACGCCCGTAGCAATGGCGGTAGCAGGAAC
TCCTCCGCGGGCAACCTGTCACAGATTCTCAGTGCTAAGCTCCGCAAGTGCTGCAAGGCG
CCATCTCCGTCCTTAACCTGCCTCCGCCTCGACCCCGAGAAGTCCCACATTGGCGTGTGG
CAAAAGCGCGCAGGGGCCCGTGCTGACTCCAACTGGGTGATGACGGTGGAGCTCAACAAA
GAGGTAGAACCAACTGAACCTGCAGCTCAGCCCACATCAACAGCAACAGCTTCGCAAGTG
ACAATGGATGATGAGGAAAAGATTGCGCTGCAAATGATCGAGGAGTTGCTGAGCAGGAGC
AGTCCAGCTTCACCCTCACATGGAGAGGGAGAGGGTAGCTTTGTCATCTGAAAGGCTTGG
ATGAAACGACG

CDS

618 bp

>Os02t0202000-01 Ethylene response factor, Transcription factor, Regulation of wax synthesis, Drought tolerance
ATGGTACAGCCAAAGAAGAAGTTTCGTGGAGTCAGGCAGCGGCACTGGGGCTCCTGGGTC
TCTGAGATCAGACACCCCCTCCTTAAAAGGAGGGTgtggctgggcacctttgagacggcc
gaggaggctgcgcgagcctacgatgaggctgctgtgctgatgagtggccgcaacgccaag
accaacttcccCGTGCAGAGGAACTCCACCGGTGATCTCGCCACGGCCGCAGACCAGGAC
GCCCGTAGCAATGGCGGTAGCAGGAACTCCTCCGCGGGCAACCTGTCACAGATTCTCAGT
GCTAAGCTCCGCAAGTGCTGCAAGGCGCCATCTCCGTCCTTAACCTGCCTCCGCCTCGAC
CCCGAGAAGTCCCACATTGGCGTGTGGCAAAAGCGCGCAGGGGCCCGTGCTGACTCCAAC
TGGGTGATGACGGTGGAGCTCAACAAAGAGGTAGAACCAACTGAACCTGCAGCTCAGCCC
ACATCAACAGCAACAGCTTCGCAAGTGACAATGGATGATGAGGAAAAGATTGCGCTGCAA
ATGATCGAGGAGTTGCTGAGCAGGAGCAGTCCAGCTTCACCCTCACATGGAGAGGGAGAG
GGTAGCTTTGTCATCTGA

Protein

206 aa

>Os02t0202000-01 Ethylene response factor, Transcription factor, Regulation of wax synthesis, Drought tolerance
MVQPKKKFRGVRQRHWGSWVSEIRHPLLKRRVWLGTFETAEEAARAYDEAAVLMSGRNAK
TNFPVQRNSTGDLATAADQDARSNGGSRNSSAGNLSQILSAKLRKCCKAPSPSLTCLRLD
PEKSHIGVWQKRAGARADSNWVMTVELNKEVEPTEPAAQPTSTATASQVTMDDEEKIALQ
MIEELLSRSSPASPSHGEGEGSFVI*

5'UTR

chr02:5688698..5688850 (+ strand) : 153 bp

CDS

chr02:5688851..5688933 (+ strand) : 83 bp

chr02:5689055..5689589 (+ strand) : 535 bp

3'UTR

chr02:5689590..5689609 (+ strand) : 20 bp

FASTA

>Os02t0202000-01 class=Sequence position=chr02:5688698..5689609 (+ strand)
GCCGCAGCAG TTTATATTCA CTCAAACAAG TGCTTTCCTC CTCCCCCACA CCTCCTCCGT TCAGTTCAGA GGCGCCTAGC
AATAGCAGCT CATTGCCTCA TCTCTGCCTC CCCTGTCCTT CTGGGGGCAG AGAATCTCTC CACTGCTGGA AAAATGGTAC
AGCCAAAGAA GAAGTTTCGT GGAGTCAGGC AGCGGCACTG GGGCTCCTGG GTCTCTGAGA TCAGACACCC CCTCCTGTAA
GCTCTTCTAT CAACATCCCT CTAATTTTCT GCTAATAATG TTATGTTTTG ATGTGTCTAA TACTCTAATC TAATAAGTAA
TAAGTCTCAA TGCATATGGT GTTTGCAACT AATGCAGTAA AAGGAGGGTg tggctgggca cctttgagac ggccgaggag
gctgcgcgag cctacgatga ggctgctgtg ctgatgagtg gccgcaacgc caagaccaac ttcccCGTGC AGAGGAACTC
CACCGGTGAT CTCGCCACGG CCGCAGACCA GGACGCCCGT AGCAATGGCG GTAGCAGGAA CTCCTCCGCG GGCAACCTGT
CACAGATTCT CAGTGCTAAG CTCCGCAAGT GCTGCAAGGC GCCATCTCCG TCCTTAACCT GCCTCCGCCT CGACCCCGAG
AAGTCCCACA TTGGCGTGTG GCAAAAGCGC GCAGGGGCCC GTGCTGACTC CAACTGGGTG ATGACGGTGG AGCTCAACAA
AGAGGTAGAA CCAACTGAAC CTGCAGCTCA GCCCACATCA ACAGCAACAG CTTCGCAAGT GACAATGGAT GATGAGGAAA
AGATTGCGCT GCAAATGATC GAGGAGTTGC TGAGCAGGAG CAGTCCAGCT TCACCCTCAC ATGGAGAGGG AGAGGGTAGC
TTTGTCATCT GAAAGGCTTG GATGAAACGA CG

Locus: Os02g0202000

Loading...

Locus: Os02g0202000

Loading...