Os02t0214300-01

Locus

Os02g0214300

Description

tRNase Z, Thermo-sensitive genic male sterility

RAP-DB Gene Symbol Synonym(s)

TMS5, OsaTRZ1

RAP-DB Gene Name Synonym(s)

Thermo-sensitive genic male sterile 5, tRNase Z1

CGSNL Gene Symbol

TMS5

CGSNL Gene Name

THERMO-SENSITIVE GENIC MALE STERILE 5

Oryzabase Gene Symbol Synonym(s)

TRZ1, OsTRZ1, OsaTRZ1, OsTMS5

Oryzabase Gene Name Synonym(s)

tRNase Z1, RNase ZS1, thermo-sensitive genic male sterile 5

Transcript Evidence

BT038741 (maize)

Protein Evidence

Q6H8B1

Literature

PMID: 30894127

PMID: 21781332

Note

Manual Curation

April 2, 2019

Functional domain (InterPro)

Ribonuclease Z/Hydroxyacylglutathione hydrolase-like (IPR036866)

Metallo-beta-lactamase (IPR001279)

Expression Databases

TENOR (Os02t0214300-00)

Others

Oryzabase (15223)

KEGG (Os02t0214300-00 (EC:3.1.26.11))

Transcript

949 bp

>Os02t0214300-01 tRNase Z, Thermo-sensitive genic male sterility
CGGCGGCGCCATGGCGAACAGCGGCAAGTCATCGCCGGCGGCGACCTCCACCACCGCGCC
GCCACCGGGTCGGCCGAAGGCGAAGGCGCCGCCCCTCACCGTCGAGGGCTACCCCGTGGA
GGGCATCTCCATCGGCGGGCAGGAGACCTGCGTCATCTTCCCGACGCTGAGCGCCGCCTT
CGACATCGGCCGGTGCCCGCAGCGCGCCGTCTCGCAGGAGTTCCTCTTCATCTCCCACGC
CCACCTCGACCACATCGGCGGCCTCCCCATGTACGTCGCCACCCGGGGCCTCTACCGGCA
GCGCCCGCCCACCATCTTCATCCCCGCCTGCCTCAGGGACCCCGTGGAGCGCCTCTTCGA
GCTCCACCGCTCCATGGACCAGTCCGAGCTCAGCCACAACCTCGTCCCCCTCGAGATTGG
TCAGGAGCACGAGCTCAGGAGGGACCTCAAGGTGAAGGCCTTCAAGACCTACCACGCCAT
TCCCAGCCAGGGGTATGTGATATACACGGTGAAGCAAAAGCTCAAGCCAGAGTATCTTGG
CCTCCCTGGGAGCGAGATCAAGCAGCTGAAGCTGTCAGGTGTGGAGATTACGAATACATT
GACGGTGCCTGAGATTGCTTTTACCGGAGATACGATGGCAGATTTCATTCTTGATCCTGA
TAATGCGGATGTTTTGAAGGCGAAAATTCTTGTAGTGGAGAGTACTTTTGTTGATGACTC
TGTTACAATTGAGCATGCAAGAGAATATGGGCACACCCATCTGTTTGAGATACTGAATCA
GTGTGACAAACTTGAAAACAAAGCTATTCTGCTAATCCACTTTTCTGCTCGTTATACCGC
AGAGGAAATTGATATAGCAATCAATAAGTTGCCACCCTCTTTCAGAAGTAGAGTTCATGC
ATTGAAGGAAGGTTTCTGACAAAGATGAAGTGATCAATCAGAAATGAAG

CDS

909 bp

>Os02t0214300-01 tRNase Z, Thermo-sensitive genic male sterility
ATGGCGAACAGCGGCAAGTCATCGCCGGCGGCGACCTCCACCACCGCGCCGCCACCGGGT
CGGCCGAAGGCGAAGGCGCCGCCCCTCACCGTCGAGGGCTACCCCGTGGAGGGCATCTCC
ATCGGCGGGCAGGAGACCTGCGTCATCTTCCCGACGCTGAGCGCCGCCTTCGACATCGGC
CGGTGCCCGCAGCGCGCCGTCTCGCAGGAGTTCCTCTTCATCTCCCACGCCCACCTCGAC
CACATCGGCGGCCTCCCCATGTACGTCGCCACCCGGGGCCTCTACCGGCAGCGCCCGCCC
ACCATCTTCATCCCCGCCTGCCTCAGGGACCCCGTGGAGCGCCTCTTCGAGCTCCACCGC
TCCATGGACCAGTCCGAGCTCAGCCACAACCTCGTCCCCCTCGAGATTGGTCAGGAGCAC
GAGCTCAGGAGGGACCTCAAGGTGAAGGCCTTCAAGACCTACCACGCCATTCCCAGCCAG
GGGTATGTGATATACACGGTGAAGCAAAAGCTCAAGCCAGAGTATCTTGGCCTCCCTGGG
AGCGAGATCAAGCAGCTGAAGCTGTCAGGTGTGGAGATTACGAATACATTGACGGTGCCT
GAGATTGCTTTTACCGGAGATACGATGGCAGATTTCATTCTTGATCCTGATAATGCGGAT
GTTTTGAAGGCGAAAATTCTTGTAGTGGAGAGTACTTTTGTTGATGACTCTGTTACAATT
GAGCATGCAAGAGAATATGGGCACACCCATCTGTTTGAGATACTGAATCAGTGTGACAAA
CTTGAAAACAAAGCTATTCTGCTAATCCACTTTTCTGCTCGTTATACCGCAGAGGAAATT
GATATAGCAATCAATAAGTTGCCACCCTCTTTCAGAAGTAGAGTTCATGCATTGAAGGAA
GGTTTCTGA

Protein

303 aa

>Os02t0214300-01 tRNase Z, Thermo-sensitive genic male sterility
MANSGKSSPAATSTTAPPPGRPKAKAPPLTVEGYPVEGISIGGQETCVIFPTLSAAFDIG
RCPQRAVSQEFLFISHAHLDHIGGLPMYVATRGLYRQRPPTIFIPACLRDPVERLFELHR
SMDQSELSHNLVPLEIGQEHELRRDLKVKAFKTYHAIPSQGYVIYTVKQKLKPEYLGLPG
SEIKQLKLSGVEITNTLTVPEIAFTGDTMADFILDPDNADVLKAKILVVESTFVDDSVTI
EHAREYGHTHLFEILNQCDKLENKAILLIHFSARYTAEEIDIAINKLPPSFRSRVHALKE
GF*

5'UTR

chr02:6397332..6397341 (+ strand) : 10 bp

CDS

chr02:6397342..6397821 (+ strand) : 480 bp

chr02:6397927..6398022 (+ strand) : 96 bp

chr02:6398132..6398245 (+ strand) : 114 bp

chr02:6398623..6398691 (+ strand) : 69 bp

chr02:6398791..6398865 (+ strand) : 75 bp

chr02:6399162..6399236 (+ strand) : 75 bp

3'UTR

chr02:6399237..6399266 (+ strand) : 30 bp

FASTA

>Os02t0214300-01 class=Sequence position=chr02:6397332..6399266 (+ strand)
CGGCGGCGCC ATGGCGAACA GCGGCAAGTC ATCGCCGGCG GCGACCTCCA CCACCGCGCC GCCACCGGGT CGGCCGAAGG
CGAAGGCGCC GCCCCTCACC GTCGAGGGCT ACCCCGTGGA GGGCATCTCC ATCGGCGGGC AGGAGACCTG CGTCATCTTC
CCGACGCTGA GCGCCGCCTT CGACATCGGC CGGTGCCCGC AGCGCGCCGT CTCGCAGGAG TTCCTCTTCA TCTCCCACGC
CCACCTCGAC CACATCGGCG GCCTCCCCAT GTACGTCGCC ACCCGGGGCC TCTACCGGCA GCGCCCGCCC ACCATCTTCA
TCCCCGCCTG CCTCAGGGAC CCCGTGGAGC GCCTCTTCGA GCTCCACCGC TCCATGGACC AGTCCGAGCT CAGCCACAAC
CTCGTCCCCC TCGAGATTGG TCAGGAGCAC GAGCTCAGGA GGGACCTCAA GGTGAAGGCC TTCAAGACCT ACCACGCCAT
TCCCAGCCAG GTGAAGGGTT CATCAGTTCT TGGTTGTTCT GGATGAATTA TTCTTGATTG ATTGATTTGG TCGGAAATGT
GTGGTGAATT TGGTTGAGAT GTGATGTGAT TGTAGGGGTA TGTGATATAC ACGGTGAAGC AAAAGCTCAA GCCAGAGTAT
CTTGGCCTCC CTGGGAGCGA GATCAAGCAG CTGAAGCTGT CAGGTGTGGA GGTCTGTTGT TGTTTTTTTT TTTTTTTGAT
ATTGTGGATG TCTGGATGAA ATGGAATACA ATTCACAATT TAGTTATGTT GTTGATGCTG TGCGTGGTTC TGTTTTTCAG
ATTACGAATA CATTGACGGT GCCTGAGATT GCTTTTACCG GAGATACGAT GGCAGATTTC ATTCTTGATC CTGATAATGC
GGATGTTTTG AAGGCGAAAA TTCTTGTAGT GGAGGTATTG CTTCTTATCG TCTATATGGT TAATTTGTTG TCAATTGTCA
TTGTTGCTAT TCAGCCTGAG AAAAAAAAAA GAGGGAAACT GTTTCTTCAA GCACGGATAT CAGTATATTA CCAAGATTAA
TTTTATCAAC AGAAGGAAAA GCAACAGCCT TTGCTTTTCA GGAGAGATTG ATTCCAACTC CATATTAACT GATAACTGAG
TACCATTTTT TCAAACTGAA ACCTTTGCGG AACCAATTGG CAGCAATTAG TGGGAACTAT GTTGCCTGAA GCATGTTTCA
GTTTCCATAC TGAATATTTA TTGTCCTTCT CCTGACGAAA TTTTAATTAT CTCCAAATTT AACTTAGTGA ACTGTGTTCT
GGAAATTGCA GAGTACTTTT GTTGATGACT CTGTTACAAT TGAGCATGCA AGAGAATATG GGCACACCCA TCTGTTTGAG
GTTATTCCCA AATTTTGCTT ATTTCATATT TCTGTGGAAG AAAAACATTT CACCTAGCAT TGCTAATTTT GCCCTTATCT
TTTTTTTTTA TGTATGCAGA TACTGAATCA GTGTGACAAA CTTGAAAACA AAGCTATTCT GCTAATCCAC TTTTCTGCTC
GTTATACCGC AGAGGTGAGC TATCTCTGTT GTAATCCAAT TTTACTTATA TCATTTTATC CTGATTCAAT TAGTAATCTG
TATGCTTTGT TTCAACTCTG TGGATTTATT TTTTGTTTCA AGCAAGTTTC ACCAATATTG TTATTTTTTA ATGCCATCAT
TATGAGCAGG CAAAATGTGC CCACTTTTCT TGTAGCATCC TCCTTTCCTC TTAAAAGTAC ACATGTTTGT GTTTCATTCT
TTACAAATAA ATACATTTAT CTTCAATTTT TTTCTCACCA TCATTAAACA TTTCATCACA TCCTTTTCAG GAAATTGATA
TAGCAATCAA TAAGTTGCCA CCCTCTTTCA GAAGTAGAGT TCATGCATTG AAGGAAGGTT TCTGACAAAG ATGAAGTGAT
CAATCAGAAA TGAAG

Locus: Os02g0214300

Loading...

Locus: Os02g0214300

Loading...