Os02t0228900-01

Locus

Os02g0228900

Description

Similar to Auxin-responsive protein IAA18 (Indoleacetic acid-induced protein 18).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

IAA7

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsIAA7, DLN51, OsDLN51

Oryzabase Gene Name Synonym(s)

Aux/IAA protein 7, DLN repressor 51, DLN motif protein 51

Transcript Evidence

AK121870 (DDBJ, Best hit)

Protein Evidence

Q6H543 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Cellular Component: nucleus (GO:0005634)

Molecular Function: protein dimerization activity (GO:0046983)

Functional domain (InterPro)

AUX/IAA protein (IPR003311)

Aux/IAA-ARF-dimerisation (IPR011525)

Full-length cDNA

J033103P10 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0228900-01)

RiceXPro (AK121870)

Others

Oryzabase (10898)

KEGG (Os02t0228900-01)

Transcript

1407 bp

>Os02t0228900-01 Similar to Auxin-responsive protein IAA18 (Indoleacetic acid-induced protein 18).
GGGCGGCATCTCAGCTCAGCTCAGGCTCAGCTAGACGCTACTCGCATCGGAGCATCACAT
TGCCGTGTGCCGTTGCTCGCATTGCAGCTGCAGCTACTACTACCATTCCCACACCTTTTC
TAGCTCTCTGTTCCACACCTCTCCCTCTTGCATTGCAGCCAAGACAGCAACCAGCAGCAG
CAGCAGCTCAGCTAGCTAGTTTCTGCTTTCTTGATTTGTTCTTGGATTTGGGCGAGCTGT
ACATCTAGAGAGCGGGTGATGGGGGAGGCGTCGGAGAGCATGAAGAAGATCAGCAGAGGC
CGTCTCGGCGGAAGCTGGATGGGGGAGCCAAGCGATCACCATCGCCATGGCGATGAACAG
GAGGAGGAGGAGAAGACGCTGGAGCTCAGCCTTGGGCTCCCCGGAGGAGGATGGCGAGCG
GCGTGCAGGGACAAGGGGACGACGACGAAGCACTCCATTGCAGCAGCTGCTGCTGCTGAT
GATGATGATGGTGACAAGAGCTCCATGCTCTCCCTGGGCTACTCCACACTCGTCTCCCAC
TCGCAAGGCAAGGCAAACAAAAACAAGGGGTCCCCAGAGGAAGAAGAGGCACATCCACCA
CCAGCTACAGGGAATAATGCACTTGCATCCAACAATAATGGCTGCTTCCAGACAAGATCT
CCTAGTACTCCTGTTGTTGGTTGGCCTCCGGTTCGAACATTCAGAAGAAATCTGGCTACA
TCCAGCAAAGCATCTCTTGAACTGCAGAATGGAAAGAAGGCTGCAAAAGCAGAAGAGATC
AAGAGAGCTCCATTCATAAAGATAAACATGGATGGTGTCCCTATTGGTAGAAAGATCGAT
CTGAATGCTTTTGATAGCTATGAGAAGCTTTCTTTAGCGGTTGACAAGCTATTCCGAGGC
CTTCTTGCAGCCCAAAGAGACCCCCTCACTGCTGGAGCAAAGGACTGCCAGCAGGAAGAT
GTGGCAATATCTGGCTTGCTAGATGGAACTGGGGAGTACACTTTGGTTTATGAGGATTAT
GAAGGCGACAAGGTGCTTGTTGGAGATGTGCCATGGGGGATGTTTGTTTCTTCAGTTAAG
AGACTGAGAGTACTGAAGACATCTGACCTCTCTTCATCTCTAATAACCTCTGGACGGAAA
AGAACAGCTGCTGAGTGTTGACCTTCTTTTTTGGAGCTGCTTTGACACATTCAGTGACCT
GCTGTGAAGAAGAATATGATCTTCTGAGCTTGTATCATCGTCTCTTTCTCTCAATGTCTT
GCTGTGCTGATCTTTTGGGGTTTTCCTGTTCCTACTTAACCAACTTGCTTCCTTCTGTTT
AAGACACTTGTGTGAAGTGAGTGCAATTTGACATGACCATCATGTAAATGTTCAGCTAAA
TGCTCTACATTTATGCAGTTTATTCTC

CDS

903 bp

>Os02t0228900-01 Similar to Auxin-responsive protein IAA18 (Indoleacetic acid-induced protein 18).
ATGGGGGAGGCGTCGGAGAGCATGAAGAAGATCAGCAGAGGCCGTCTCGGCGGAAGCTGG
ATGGGGGAGCCAAGCGATCACCATCGCCATGGCGATGAACAGGAGGAGGAGGAGAAGACG
CTGGAGCTCAGCCTTGGGCTCCCCGGAGGAGGATGGCGAGCGGCGTGCAGGGACAAGGGG
ACGACGACGAAGCACTCCATTGCAGCAGCTGCTGCTGCTGATGATGATGATGGTGACAAG
AGCTCCATGCTCTCCCTGGGCTACTCCACACTCGTCTCCCACTCGCAAGGCAAGGCAAAC
AAAAACAAGGGGTCCCCAGAGGAAGAAGAGGCACATCCACCACCAGCTACAGGGAATAAT
GCACTTGCATCCAACAATAATGGCTGCTTCCAGACAAGATCTCCTAGTACTCCTGTTGTT
GGTTGGCCTCCGGTTCGAACATTCAGAAGAAATCTGGCTACATCCAGCAAAGCATCTCTT
GAACTGCAGAATGGAAAGAAGGCTGCAAAAGCAGAAGAGATCAAGAGAGCTCCATTCATA
AAGATAAACATGGATGGTGTCCCTATTGGTAGAAAGATCGATCTGAATGCTTTTGATAGC
TATGAGAAGCTTTCTTTAGCGGTTGACAAGCTATTCCGAGGCCTTCTTGCAGCCCAAAGA
GACCCCCTCACTGCTGGAGCAAAGGACTGCCAGCAGGAAGATGTGGCAATATCTGGCTTG
CTAGATGGAACTGGGGAGTACACTTTGGTTTATGAGGATTATGAAGGCGACAAGGTGCTT
GTTGGAGATGTGCCATGGGGGATGTTTGTTTCTTCAGTTAAGAGACTGAGAGTACTGAAG
ACATCTGACCTCTCTTCATCTCTAATAACCTCTGGACGGAAAAGAACAGCTGCTGAGTGT
TGA

Protein

301 aa

>Os02t0228900-01 Similar to Auxin-responsive protein IAA18 (Indoleacetic acid-induced protein 18).
MGEASESMKKISRGRLGGSWMGEPSDHHRHGDEQEEEEKTLELSLGLPGGGWRAACRDKG
TTTKHSIAAAAAADDDDGDKSSMLSLGYSTLVSHSQGKANKNKGSPEEEEAHPPPATGNN
ALASNNNGCFQTRSPSTPVVGWPPVRTFRRNLATSSKASLELQNGKKAAKAEEIKRAPFI
KINMDGVPIGRKIDLNAFDSYEKLSLAVDKLFRGLLAAQRDPLTAGAKDCQQEDVAISGL
LDGTGEYTLVYEDYEGDKVLVGDVPWGMFVSSVKRLRVLKTSDLSSSLITSGRKRTAAEC
*

5'UTR

chr02:7248331..7248588 (- strand) : 258 bp

CDS

chr02:7248042..7248330 (- strand) : 289 bp

chr02:7247267..7247375 (- strand) : 109 bp

chr02:7246121..7246374 (- strand) : 254 bp

chr02:7245722..7245869 (- strand) : 148 bp

chr02:7245437..7245497 (- strand) : 61 bp

chr02:7245303..7245344 (- strand) : 42 bp

3'UTR

chr02:7245057..7245302 (- strand) : 246 bp

FASTA

>Os02t0228900-01 class=Sequence position=chr02:7245057..7248588 (- strand)
GGGCGGCATC TCAGCTCAGC TCAGGCTCAG CTAGACGCTA CTCGCATCGG AGCATCACAT TGCCGTGTGC CGTTGCTCGC
ATTGCAGCTG CAGCTACTAC TACCATTCCC ACACCTTTTC TAGCTCTCTG TTCCACACCT CTCCCTCTTG CATTGCAGCC
AAGACAGCAA CCAGCAGCAG CAGCAGCTCA GCTAGCTAGT TTCTGCTTTC TTGATTTGTT CTTGGATTTG GGCGAGCTGT
ACATCTAGAG AGCGGGTGAT GGGGGAGGCG TCGGAGAGCA TGAAGAAGAT CAGCAGAGGC CGTCTCGGCG GAAGCTGGAT
GGGGGAGCCA AGCGATCACC ATCGCCATGG CGATGAACAG GAGGAGGAGG AGAAGACGCT GGAGCTCAGC CTTGGGCTCC
CCGGAGGAGG ATGGCGAGCG GCGTGCAGGG ACAAGGGGAC GACGACGAAG CACTCCATTG CAGCAGCTGC TGCTGCTGAT
GATGATGATG GTGACAAGAG CTCCATGCTC TCCCTGGGCT ACTCCACACT CGTCTCCCAC TCGCAAGGTA CAGATAAAAG
AAAAAGTTCA CAACTCTGTA ACTGATCTCG TGTTCTTGCG ATGTCAGTTG CATGTTACTG TAATAGACAT CTAGTTATAC
GTGTGTTTTT GTTAGTGTTT TGGTGTTGTG ACATACCACA AAAATGTGCC TCATTTTCTG ATGAAACTTA GTTAGATATA
TGGGTAATGC AGCGTTTGAG ACCTGAGCAG AAATGTGTGT GCCATTGCTC TCAACTCTGA AGTAGGAGTG GTTTCTAAAA
TTTGGCTGAG GAGAATGAGC AGAAAAGAAA CCTGAAAAAT TAGTTGTTAA GAAGATTGTT GTTAAGAACT TTTTGTGTTT
TTATTGGGGG GAGCTGATAG GTGCACTGAA CTTTTAACAG TATGGTTTCA GAGGTTTAGT TGACTTGATA TATACTTGTG
GTAAACACTG CTCAAGAAAA TACTTGTGGT AAGTGTGTTT ACATAAGAAA CCTAGGTAAT ATCATTGTTG TTTAATGAAA
AATCCATTAT CTGACAAAAA AAAAGAAGTA TTGCATATGA GTAGAATATT GCATCATTGG TTCTTCTTCA ATCTTGATTG
CATGTGCCAT GCTCAAAAGT CAAGAACAGC AGGGGAAAAA GTTCTCTGAA GCATGATATC ACATCTTGTT TCTTCCTCCT
TGTTCTTGTG CAGGCAAGGC AAACAAAAAC AAGGGGTCCC CAGAGGAAGA AGAGGCACAT CCACCACCAG CTACAGGGAA
TAATGCACTT GCATCCAACA ATAATGGCTG CTTCCAGACA AGGTTGGGAA TCATAAGGGC CTCTCCTCAC ATGTCAAAAA
TTCCACAGCA CCATAATCTT TTGCTTTTTA TGAGTGGGCA AACTCAACTA TTGGATTGGT AGCTAGCTAC TAGCTCCTGA
TTCTTTTATT CCTCATTTCC TCCTCATCTG CATGAATTGA AGAGGGAGAT GCCTCCATCT CCTGCATGCC TGCTCCTCAT
TTATGACAAA AACCATTTTG CTTGTTTGCT TCTGCCTGCC TGCATGCTAT CCATGGAGAT AGATAGATAG ATCTCCTACT
CCATTTATGA GGGATGCAGT TGTCTTTGTC AACATGTAGT ACTGTTTGTT GTTTACTTTC TAGTTTGTCC CTTCTGTTCA
TGACAGTTGT TGTTAGTTCA CCTGACATAC CTGGTTGCAG GATTATTTAC TTAAGTATAA TTTCAGGAAA ATTGATCATA
TGCCACCCTT TAGATTGCAT CCATTTATAA GCCACTCTTG TGTCACCATA TATAGGCAAA GCTTTGGCAT TAGCTAGCAA
TCATTTACTG GTGTTGTACA CCATCAGGCA CTAAGCTTCC TGATCTGAAT GTAGACTACT ACAATGTGTA TGTTTTAATT
TGAACATCCT TTTTCCAGAG AAATAGTTTC TGATGCATAG GTGATTTAGG ATTTGTACAA AAAACGGAAA TTGAAAGGTA
ATAACTATAG CTAGTCAGAT ACTCTATTTT GTAGTTTGAT GTAGTTATTC TTTGCAAAAT AATATATGAT ACCATTTCTG
AACTTTTCAA CCTTGAAAAA TAGTAACTAT AGCTAGTCAG ATACTCTAGT TTTAGTTTGC TGTAGTTATT ATTTGCAAAA
TAATACAGGA GATCATTTCT GAACCTTTTT CAACCTGACA ACCTCGAAAT GCAGATCTCC TAGTACTCCT GTTGTTGGTT
GGCCTCCGGT TCGAACATTC AGAAGAAATC TGGCTACATC CAGCAAAGCA TCTCTTGAAC TGCAGAATGG AAAGAAGGCT
GCAAAAGCAG AAGAGATCAA GAGAGCTCCA TTCATAAAGA TAAACATGGA TGGTGTCCCT ATTGGTAGAA AGATCGATCT
GAATGCTTTT GATAGCTATG AGAAGCTTTC TTTAGCGGTT GACAAGCTAT TCCGAGGCCT TCTTGCAGGT ATATGAACCT
CAACTCTGTT GTTTTGTAAC ACAATTAAAT CATTCAATTG CGACTGCAGT TTATGATAGA GTATCTGAAG AGTTTTCCAC
TGATACTGAA CCATGGCACT GCATAAATTA TTTCCTTATT GTTCTTTCGA AAGTTCGCAA ATTATTTCTT TGTTATTTTC
AGTATTTTGA AATTTGAATG GCTGAGTTAT CGGATTAGTA TCTGATCCAA TGTGTTCAAT TTCCGTCGTT GTATTTAAGC
CCAAAGAGAC CCCCTCACTG CTGGAGCAAA GGACTGCCAG CAGGAAGATG TGGCAATATC TGGCTTGCTA GATGGAACTG
GGGAGTACAC TTTGGTTTAT GAGGATTATG AAGGCGACAA GGTGCTTGTT GGAGATGTGC CATGGGGGTG AGTTTTTCGT
TTTACCGTTG CATTTTCAGA GAGTAGTAAA CAAAGTTACT ACTTTTATTG GATGCTGATT ATGCAAACAG CAATGCTTGA
AAATGATATG CAGTCTATTC CCTTGTTTTT TTTAAAAAAT TTATTGATTA TCAAACTGGG AGAAAATAAT TTTACCATCA
AACTGGACCA TATGCCTCCT AACTGATAGT CTGATACTGC AATTCATGCA GGATGTTTGT TTCTTCAGTT AAGAGACTGA
GAGTACTGAA GACATCTGAC CTCTCTTCAT CTGTCAGTAC CTCTTTCCAC CTTAGTTCTA TTACATCAAA CTCTGTTATC
TCCGCATTAT TCTGAAATTT GTTCACGCCA TGTAATCCAT GCAGCTAATA ACCTCTGGAC GGAAAAGAAC AGCTGCTGAG
TGTTGACCTT CTTTTTTGGA GCTGCTTTGA CACATTCAGT GACCTGCTGT GAAGAAGAAT ATGATCTTCT GAGCTTGTAT
CATCGTCTCT TTCTCTCAAT GTCTTGCTGT GCTGATCTTT TGGGGTTTTC CTGTTCCTAC TTAACCAACT TGCTTCCTTC
TGTTTAAGAC ACTTGTGTGA AGTGAGTGCA ATTTGACATG ACCATCATGT AAATGTTCAG CTAAATGCTC TACATTTATG
CAGTTTATTC TC

Locus: Os02g0228900

Loading...

Locus: Os02g0228900

Loading...