Os02t0244100-01

Locus

Os02g0244100

Description

RING-type E3 ubiquitin ligase, Regulation of grain width and weight

RAP-DB Gene Symbol Synonym(s)

GW2, OsGW2

RAP-DB Gene Name Synonym(s)

GRAIN WEIGHT 2, GRAIN WIDTH AND WEIGHT2

CGSNL Gene Symbol

GW2

CGSNL Gene Name

GRAIN WEIGHT 2

Oryzabase Gene Symbol Synonym(s)

OsGW2

Oryzabase Gene Name Synonym(s)

GRAIN WIDTH AND WEIGHT2, Grain width 2

Transcript Evidence

EF447275 (Fengaizhan-1, 6bp insertion in CDS)

AK065504

Protein Evidence

A4GWX9

Q6ESV2

Literature

PMID: 17417637

Note

Manual Curation

February 25, 2015

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Molecular Function: zinc ion binding (GO:0008270)

Functional domain (InterPro)

Zinc finger, RING/FYVE/PHD-type (IPR013083)

Zinc finger, RING-type (IPR001841)

Full-length cDNA

J013027C16 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0244100-01)

RiceXPro (AK065504)

Others

Oryzabase (8900)

KEGG (Os02t0244100-01)

Transcript

1820 bp

>Os02t0244100-01 RING-type E3 ubiquitin ligase, Regulation of grain width and weight
GCAGCAGAGAGGTCTCCACTTCCCTTTCCTCCCACCCCGAGAAAGCCAAAAAAAGAAAAA
TTATTTTTCAAAAAAAAAGCTCGCCTCGCCCTCGCGTCGTCGTCCCCATCACCCCCCCTC
CTCCGCTCCGAGTACGCGTGCGTATACCACCACCTCCATCTCCACCACCGTATGTATCTA
CGGTGAGGCGGCGGCGGCGGAGGAGGAGGAGGAGGGGGAGTGGTGAGGGTTTCATCTGCG
GAGGAGGAGGGAGGAGGAGGGAGGAGGGTAGATCTGGGAGGGGGATGGGGAACAGGATAG
GGGGGAGGAGGAAGGCGGGGGTGGAGGAGAGGTACACGAGGCCGCAGGGGCTGTACGAGC
ACAGGGACATCGACCAGAAgaagctccggaagctgatcctcgaggccaagctcgcgccgt
gctacatgggcgccgacgacgccgccgccgccgccgacctcgaggagtgccccatctgct
tcctgTACTACCCAAGTCTTAACCGATCAAAGTGTTGCTCAAAAGGGATATGCACCGAGT
GCTTTCTCCAAATGAAACCAACTCACACTGCTCAGCCTACACAATGTCCATTCTGCAAAA
CTCCCAGTTATGCTGTGGAGTATCGTGGTGTAAAGACAAAGGAGGAAAGGAGCATAGAAC
AATTTGAAGAGCAGAAAGTCATAGAAGCACAAATGAGGATGCGCCAGCAAGCACTTCAAG
ATGAAGAAGATAAGATGAAAAGAAAACAGAACAGGTGCTCTTCTAGCAGAACAATCACAC
CGACCAAAGAAGTGGAGTATAGAGATATTTGCAGCACATCCTTTTCAGTGCCGTCATACC
GATGTGCTGAGCAAGAAACTGAATGCTGTTCATCGGAACCTTCATGCTCTGCCCAGACTA
GCATGCGCCCTTTCCATTCTAGGCATAACCGTGATGATAACATTGACATGAATATAGAGG
ATATGATGGTTATGGAAGCGATTTGGCGTTCCATTCAGGGAAGTATAGGGAATCCTGTCT
GTGGCAACTTTATGCCTGTAACTGAGCCATCTCCGCGTGAACGCCAGCCATTCGTTCCAG
CTGCTTCTCTAGAAATACCTCATGGTGGTGGATTTTCCTGTGCGGTTGCGGCAATGGCTG
AGCACCAGCCACCCAGTATGGACTTCTCTTACATGGCTGGCAGCAGCGCATTCCCAGTTT
TCGACATGTTCCGGCGACCATGCAACATTGCTGGTGGAAGCATGTGTAATCTGGAGAGCT
CACCGGAGAGCTGGAGCGGGATAGCACCAAGCTGCAGCAGGGAAGTGGTAAGAGAAGAAG
GAGAGTGCTCGGCTGACCACTGGTCGGAGGGTGCAGAGGCCGGAACAAGCTACGCGGGCT
CAGACATCGTGGCAGATGCCGGGACCATGCCGCAGCTGCCTTTCGCCGAGAACTTCGCCA
TGGCGCCAAGCCACTTCCGCCCGGAGAGCATCGAAGAACAGATGATGTTTTCCATGGCTC
TTTCTTTAGCAGATGGTCATGGAAGAACACACTCGCAAGGGTTGGCATGGTTGTAGGTAG
AGCACTCTAATTTTGACGCCTTGCTGCCCTCTCCCTTGCGCTGCTGTTGCTGCCCTTCTC
TCCCCTGCCTCCTGCTTCTGCCTCCTTTTTGCCACCAGCTCTTGGCCTTTTTGTTCACCC
CTTTTTTGCATGTGTTTTGTCGTCATGGTTTGATATAGATCCAGCTATAGCTCTCCATTG
TTATTGCTTATATGTATGTAAAATGGAATATGAGGAAATAGAAAAAAGGAAAATGGGTCA
ACAGTTCTTTTGGCAGTAGG

CDS

1272 bp

>Os02t0244100-01 RING-type E3 ubiquitin ligase, Regulation of grain width and weight
ATGGGGAACAGGATAGGGGGGAGGAGGAAGGCGGGGGTGGAGGAGAGGTACACGAGGCCG
CAGGGGCTGTACGAGCACAGGGACATCGACCAGAAgaagctccggaagctgatcctcgag
gccaagctcgcgccgtgctacatgggcgccgacgacgccgccgccgccgccgacctcgag
gagtgccccatctgcttcctgTACTACCCAAGTCTTAACCGATCAAAGTGTTGCTCAAAA
GGGATATGCACCGAGTGCTTTCTCCAAATGAAACCAACTCACACTGCTCAGCCTACACAA
TGTCCATTCTGCAAAACTCCCAGTTATGCTGTGGAGTATCGTGGTGTAAAGACAAAGGAG
GAAAGGAGCATAGAACAATTTGAAGAGCAGAAAGTCATAGAAGCACAAATGAGGATGCGC
CAGCAAGCACTTCAAGATGAAGAAGATAAGATGAAAAGAAAACAGAACAGGTGCTCTTCT
AGCAGAACAATCACACCGACCAAAGAAGTGGAGTATAGAGATATTTGCAGCACATCCTTT
TCAGTGCCGTCATACCGATGTGCTGAGCAAGAAACTGAATGCTGTTCATCGGAACCTTCA
TGCTCTGCCCAGACTAGCATGCGCCCTTTCCATTCTAGGCATAACCGTGATGATAACATT
GACATGAATATAGAGGATATGATGGTTATGGAAGCGATTTGGCGTTCCATTCAGGGAAGT
ATAGGGAATCCTGTCTGTGGCAACTTTATGCCTGTAACTGAGCCATCTCCGCGTGAACGC
CAGCCATTCGTTCCAGCTGCTTCTCTAGAAATACCTCATGGTGGTGGATTTTCCTGTGCG
GTTGCGGCAATGGCTGAGCACCAGCCACCCAGTATGGACTTCTCTTACATGGCTGGCAGC
AGCGCATTCCCAGTTTTCGACATGTTCCGGCGACCATGCAACATTGCTGGTGGAAGCATG
TGTAATCTGGAGAGCTCACCGGAGAGCTGGAGCGGGATAGCACCAAGCTGCAGCAGGGAA
GTGGTAAGAGAAGAAGGAGAGTGCTCGGCTGACCACTGGTCGGAGGGTGCAGAGGCCGGA
ACAAGCTACGCGGGCTCAGACATCGTGGCAGATGCCGGGACCATGCCGCAGCTGCCTTTC
GCCGAGAACTTCGCCATGGCGCCAAGCCACTTCCGCCCGGAGAGCATCGAAGAACAGATG
ATGTTTTCCATGGCTCTTTCTTTAGCAGATGGTCATGGAAGAACACACTCGCAAGGGTTG
GCATGGTTGTAG

Protein

424 aa

>Os02t0244100-01 RING-type E3 ubiquitin ligase, Regulation of grain width and weight
MGNRIGGRRKAGVEERYTRPQGLYEHRDIDQKKLRKLILEAKLAPCYMGADDAAAAADLE
ECPICFLYYPSLNRSKCCSKGICTECFLQMKPTHTAQPTQCPFCKTPSYAVEYRGVKTKE
ERSIEQFEEQKVIEAQMRMRQQALQDEEDKMKRKQNRCSSSRTITPTKEVEYRDICSTSF
SVPSYRCAEQETECCSSEPSCSAQTSMRPFHSRHNRDDNIDMNIEDMMVMEAIWRSIQGS
IGNPVCGNFMPVTEPSPRERQPFVPAASLEIPHGGGFSCAVAAMAEHQPPSMDFSYMAGS
SAFPVFDMFRRPCNIAGGSMCNLESSPESWSGIAPSCSREVVREEGECSADHWSEGAEAG
TSYAGSDIVADAGTMPQLPFAENFAMAPSHFRPESIEEQMMFSMALSLADGHGRTHSQGL
AWL*

5'UTR

chr02:8115223..8115506 (+ strand) : 284 bp

CDS

chr02:8115507..8115707 (+ strand) : 201 bp

chr02:8116996..8117047 (+ strand) : 52 bp

chr02:8117133..8117178 (+ strand) : 46 bp

chr02:8117271..8117352 (+ strand) : 82 bp

chr02:8117431..8117593 (+ strand) : 163 bp

chr02:8117686..8117788 (+ strand) : 103 bp

chr02:8119485..8119551 (+ strand) : 67 bp

chr02:8120830..8121387 (+ strand) : 558 bp

3'UTR

chr02:8121388..8121651 (+ strand) : 264 bp

FASTA

>Os02t0244100-01 class=Sequence position=chr02:8115223..8121651 (+ strand)
GCAGCAGAGA GGTCTCCACT TCCCTTTCCT CCCACCCCGA GAAAGCCAAA AAAAGAAAAA TTATTTTTCA AAAAAAAAGC
TCGCCTCGCC CTCGCGTCGT CGTCCCCATC ACCCCCCCTC CTCCGCTCCG AGTACGCGTG CGTATACCAC CACCTCCATC
TCCACCACCG TATGTATCTA CGGTGAGGCG GCGGCGGCGG AGGAGGAGGA GGAGGGGGAG TGGTGAGGGT TTCATCTGCG
GAGGAGGAGG GAGGAGGAGG GAGGAGGGTA GATCTGGGAG GGGGATGGGG AACAGGATAG GGGGGAGGAG GAAGGCGGGG
GTGGAGGAGA GGTACACGAG GCCGCAGGGG CTGTACGAGC ACAGGGACAT CGACCAGAAg aagctccgga agctgatcct
cgaggccaag ctcgcgccgt gctacatggg cgccgacgac gccgccgccg ccgccgacct cgaggagtgc cccatctgct
tcctggtaTA AAACCGCCTC CGGGGAGATG TGGCGGGTGG ACGGGAGGAA GAGATCTCTC CCCTCTTCCT CACTTCCTCC
TCCCGCTTCC TTCCACTTCA GCTTTTTCTC TCTTTTTTTT TGGTGGGATT TTGTCGTAAT GCTACTACTA GTACTTGTTG
TTGCGAGAGT AGGGCGTGGA TTGCGTGTGG CCGGGTGGTG GCGTGGAGCG TTTCGATTAG GGGGTTGATT ACTTTTGCTC
CTGTTCGATT GTGGAGAGTG CCGGTGGTGT GTGGCCGTTA TGGAGATGGA TGACCACGCG CAGTGTTTTG GGGCAAGAAT
TTCAGTCGAC ATTGGCACGG TTTTGGGGTT GTTTGTATTG TTCTTGGATA ATTAGTGCGG TTCGTGGAGC TGATTTTGCG
AAATGTAGTA GTAGTGTTTG AATTATTTCT GGTAGTTAGT AGTGGTATCA TACTTCGTAT GTACATTGTC CGCAATGTTC
TCCTAAATTG TTTTGTTTTC TTAATCATAG TTTACTTACT TTTATTATGT AATTCTGAGA TACGTTTTTT TGGGATAATT
ATAGTCTAGG AGGTTTTGGG TACTCATTTA TTATTGTCAA TATTCTATAG GCCTATCTAT TGGCTGCCTG GCTGTGATGC
ATTGCATGAA ATTTAATGTT TACTGCCACT CCCGGGGTTG GGACATTACA GACCTTATAG GAAATTTGAC TAGTTTCATA
AATGAATAAT TGGCCAACTG TTCTGCAATG TTGGGTGCCT TCAATTTCTA ATAGTGGATG CTCTATAGAG TACGGAGGTA
CCATGGTGAT ATTTGTTTGT TGTGTGTAAT ACTTTATTTT TGGTGTATTA ATGCTCTTGG GAACCGAGAT TGAGAATCTA
TTGTAGTGAA CTTGATTCTG TTAGCTGTGC CAGAGTATTT TCGATGTCTC TTGTCAAGCC TGCATTTATT TGGCACAAAG
TAGATTTTTT AAAAAAAAAT TCTGCAGCTT TAATGCTACT AGCTTACTGC AATTAATGTT ATTACTATAT AGGAATTTTA
ATGCAATTCT ATATGGTTGC AATTTTATTG CAATTCTGCT TCATTAGATC TTTAGCTCAA AATCACTCAA TAAATTTGGT
TTTAGATGAA ATCATGAAAC TTGTATTATA GGAGTATATT ATATTTGGTG TTGAATTATA TGTTTGCATT TGTGCTAATA
GTGGTATTTA ACAATTATCA CTTCTGGTAT TTCTGAGTTC AAACTGTTTG ACAACCACTC CTGTCCTGAA ATGCATGTTT
TCTTTCTTTG TAGTACTACC CAAGTCTTAA CCGATCAAAG TGTTGCTCAA AAGGGATATG CACCGGTAAT ACATCTATCC
TATAACTAAC AATTGTGTTT TACTTGTTAG GACCATATAC CCTTATATTC AATGGTTGGT TTTTTTGCAG AGTGCTTTCT
CCAAATGAAA CCAACTCACA CTGCTCAGCC TACACAGTAT CCTTTGTGTC ACCCTTGATT ATATTTTGTA ACCTTGGCAG
TTGGCAATCT ATATTCCTTT TTATGAAAAA AATACTTAAC CAATAAAGAT GTCCATTCTG CAAAACTCCC AGTTATGCTG
TGGAGTATCG TGGTGTAAAG ACAAAGGAGG AAAGGAGCAT AGAACAATTT GTAAGTAATT TATATTCTGA TGTTTTTTTT
TTGTTTTGCC AAATGCATTT CATTTATCTC ACATAATATG TGTTACAGGA AGAGCAGAAA GTCATAGAAG CACAAATGAG
GATGCGCCAG CAAGCACTTC AAGATGAAGA AGATAAGATG AAAAGAAAAC AGAACAGGTG CTCTTCTAGC AGAACAATCA
CACCGACCAA AGAAGTGGAG TATAGAGATA TTTGCAGCAC ATCCTTTTCA GGTCTGCACA GGCTGCAACT AACATAGAAA
TTTAGTAATG TACCATTTCT TCTGCTTGAT GTGGTAATTT ACTATGTGTT ATGTCTGTTT CAGTGCCGTC ATACCGATGT
GCTGAGCAAG AAACTGAATG CTGTTCATCG GAACCTTCAT GCTCTGCCCA GACTAGCATG CGCCCTTTCC ATTCTAGGCA
TAACCGGTAT GTTATTATCT TTTTCTCTGA GTTTTAGGGT GTCATTGTAG CCTGGTTATG TTGAACTGCA AACCTTACTA
CACTTCTATG TTAAATACCC TACCTCAACC ATGTTGAAGG GAAGCAAATG AGAAGTATTG TTAAAATAGG ATAAAGGAAA
GTAACAGTAT TATCTATAGA ATCAAATCGA TAACAAAGAT CAACCGTTGG ATTAAATTGG ATAGTGGGGA CCAGACACCA
TAAAACACTG GCATTTCGGA CAAGATCATT TAATTATTCC ACTTTAAGCT TGTGCAGTCT GTCCTGATCC ACTGCACTAT
TTAAGTGGAT GAGAAGCTGT GATTGGAGTT ACTGTTCTAG TGTTAAGGTT GACTTGTATC AGATACAATT GCCTATCCAG
TGACAAAGTT TGAATGTTTA ATTTGTGAAA GTGTGAATGG AGAGAATTTC TGCCCACATC ATTGTTGTAC CATGATAGTT
ACAGTAATCT TTAGTTTATC TATACTCTAG AGGGATAAAA ACACCAAAAC AGTTTGATCA AAATTGTTCG AGGTAAATCC
TAAGTATAAA ATTGAGAATG GATTTGTTTT TCAATATGGT TATTTGTTAT CGACATTCAG TGTTTTTATT TCACACAATG
GCCAATTCCG AAAAAACAAT CTGGGTTCTT TTTATCCCAC TGTCCATACC AAGTTGATGT AGCAAGTAAC TACTACACAA
AATAGTATAT TGTAGCCCTT TACATGCATC CAATAGATTA AGTGGTCTTC AATCCAAGGA TGAAATAAGC AATAACGTAG
GTTCCGATAC CAAATTAGCA CAAAACAATG CTAAATGCTT TTAGAGGAAG TAAACCACTC ATTTGGTTCT TTTACCTATA
AACTTGTGTT CGCTTGATGT TCTCAATATT GTCAGGCTAT TTTATAGACT TGAGGAGTAA ACATTTCTTG ATGACGTTAT
CTTCTCCTAT TGTGCTAGAC ATAAAATACA GTGTAGCATA ACTTGTGTAC TGTGAGTTTT TTTCAAGTTT TTCTTGATGC
TGCACAATAG TATACAACAA TCGTCTATTC AGTCACACAT GGCACATCCT CACATCAAAC AGAAGTTACT TTTTATGATG
TTAATGTGTA GTATAACAGC AGAAGCTAAA CGGTAGAGGG ATACAGGATA CTCGAGTCAA TATGAAGTTG GGGTTCCATG
GAGTATTTGA ATCGAATAAA ACATCTTGAT GATCAATATT GGTTTTCATA TTGTTTCTAT AAGCTAGTTT CATATTTTTC
TAGAGAACCT ATTATTATTT TGCTTCCTGT CCTCCTCAGA AGATTGACAT TCTGTACTGG TAGTGAATTT GTGTTTCCCT
CATACCCTGT TTGGGAGGGT TTCAACGTCA GCTTAGTGCA GTGCTGCAAA GTTTAAACTC TATGACCAGA GCATAAGTAT
GGCTTAAGGA CTTCTGATGA CAAAGCCATT TTTGAAACCT GAAGCCTATT TTGATCAACT TATGAACTTA TATGGAAAAC
CAGTTTCTGA AAGAGGCCAA ATATCAATAA ATGGTGCCTT AATCTCCCTT CAGTTTTATA GTTTACCATA TGGATATTTT
TCCTGTACTA AGTGTTTCTT GCTTGCTGGT CATGATAATC CTTTATGCTG TTGAGATGAA AATGGTTTCT AAAATTATGA
AACTGTGTGT TTCCCCTTAC AGTGATGATA ACATTGACAT GAATATAGAG GATATGATGG TTATGGAAGC GATTTGGCGT
TCCATTCAGG TTAGTAGTTT TCTCACTGGT CCTTACATGA GATTATTGAT AATATGCATA TGGCATACTG TGGATAATAT
TATAAAAGCT GATTTGTTGG GTCAGGTAAT GGTTTGTAAA TGAGCTGCAC AAAAATAGAT TGTTATTTGC ATTGAACATG
AAAGTTTGCT AATCTCCTGG CATGCTTGTT GAATTCAGAG CATTTTGCGA GTTCTGATAA ATGCAAGATC TAGTCTGCAC
AAGCAGAACC TGTATTGTTA AGTGTTCAAT AATAAAAAAA AATGTCAATT AAATTGTTGA GAAGTGTATT GGCGATAGTG
GATAATGTAG GATATGTTTG GTTTGAGGGA CCAACATCAG TTAGTTCATC ATTGCCTCAT TCCTCAGGCA CATGCTAGTG
GAAAAATGAG TAATGCAGTA TTCATGCCAA AATCATCCTA GATGGTGTGA TTCCTCAAAC AAAACAGGCC AGTAGATGAT
GGGGTTGGTA AGATAAGTTA TCTTTTTGTC ATTTTACTTG AGCAGTACTG CGCTTGGCAC AAAAATATTT CTGGTCATTT
TGTGAGAACA AGAGGACTTT TCACATTCCT GCATTCCTGA AGGGAACTTA TTATCTAACA GCATTGCTAA ACTCAGCTCT
TCCCATGCCC TTAGCCATCA AATTGATTTG TTATGATGGT TGCATTGTTA GTTTTGCGGT CCCAATTATT AGCCACTTAA
CGTTCAGGTC AGGAACTAAT GGTGTTTTTT TTCTCCGTCC TTTGTGTTAt actacctcca tcctaaaata agtgcagcca
tgagtttccg cgcccaactt tgatcgtccg ttttatttga aattttttta taattagcat ttttgttgtt ataagatgat
aaaacatgaa tagtacttta ctcgtgactt atgtttttga ttttttcaaa aaaatttcaa ataagacgaa tggtcaaagt
tgggcgctga aaaccatggc tgcacttatt ttgggacgga ggtagtaTCA TTTATTCATT TGCTGTTCAA GCTGTAGCTC
ATCGTGTACT GTTCCCCAAT AAGTTGCTTG CCATTTGGTC TATGTTTCCA GCTTCTTTCT TTTGTGAGCA TTTTTCCTTC
TGTATAGCTT GTTACTAGAA AGATGTAAAC TTTATGTTAA ATGCTGCTTC ATCTTTGAAT TTAGATTCTT GGGAATAAAC
AATAAGCAAA GTTCATGTAT TGCGTATAGA AAAGTCTGCA TATATTTCTA TCCTAATACG GTCAATCTTT TCTCTGAGCA
GGAGCAGGGA AGTATAGGGA ATCCTGTCTG TGGCAACTTT ATGCCTGTAA CTGAGCCATC TCCGCGTGAA CGCCAGCCAT
TCGTTCCAGC TGCTTCTCTA GAAATACCTC ATGGTGGTGG ATTTTCCTGT GCGGTTGCGG CAATGGCTGA GCACCAGCCA
CCCAGTATGG ACTTCTCTTA CATGGCTGGC AGCAGCGCAT TCCCAGTTTT CGACATGTTC CGGCGACCAT GCAACATTGC
TGGTGGAAGC ATGTGTAATC TGGAGAGCTC ACCGGAGAGC TGGAGCGGGA TAGCACCAAG CTGCAGCAGG GAAGTGGTAA
GAGAAGAAGG AGAGTGCTCG GCTGACCACT GGTCGGAGGG TGCAGAGGCC GGAACAAGCT ACGCGGGCTC AGACATCGTG
GCAGATGCCG GGACCATGCC GCAGCTGCCT TTCGCCGAGA ACTTCGCCAT GGCGCCAAGC CACTTCCGCC CGGAGAGCAT
CGAAGAACAG ATGATGTTTT CCATGGCTCT TTCTTTAGCA GATGGTCATG GAAGAACACA CTCGCAAGGG TTGGCATGGT
TGTAGGTAGA GCACTCTAAT TTTGACGCCT TGCTGCCCTC TCCCTTGCGC TGCTGTTGCT GCCCTTCTCT CCCCTGCCTC
CTGCTTCTGC CTCCTTTTTG CCACCAGCTC TTGGCCTTTT TGTTCACCCC TTTTTTGCAT GTGTTTTGTC GTCATGGTTT
GATATAGATC CAGCTATAGC TCTCCATTGT TATTGCTTAT ATGTATGTAA AATGGAATAT GAGGAAATAG AAAAAAGGAA
AATGGGTCAA CAGTTCTTTT GGCAGTAGG