Os02t0244300-01

Locus

Os02g0244300

Description

Ubiquitin-specific protease, Deubiquitination enzyme, Positive regulation of grain width and size

RAP-DB Gene Symbol Synonym(s)

OsUBP15, LG1

RAP-DB Gene Name Synonym(s)

ubiquitin-specific protease15, large grain1

CGSNL Gene Symbol

LG1

CGSNL Gene Name

LARGE GRAIN 1

Oryzabase Gene Symbol Synonym(s)

OsLG1, OsUBP15, UBP15, OsUBP15/LG1, OsUBP7-1, UBP7-1

Oryzabase Gene Name Synonym(s)

large grain1, large grain 1, ubiquitin-specific protease15, ubiquitin-specific processing protease 7-1

Transcript Evidence

AK121968

Protein Evidence

Q0E2F9

Literature

PMID: 30796160

Note

Manual Curation

May 8, 2019

Gene Ontology (GO)

Biological Process: ubiquitin-dependent protein catabolic process (GO:0006511)

Biological Process: protein deubiquitination (GO:0016579)

Molecular Function: thiol-dependent ubiquitinyl hydrolase activity (GO:0036459)

Functional domain (InterPro)

Papain-like cysteine peptidase superfamily (IPR038765)

Zinc finger, MYND-type (IPR002893)

Ubiquitin specific protease domain (IPR028889)

Peptidase C19, ubiquitin carboxyl-terminal hydrolase (IPR001394)

Ubiquitin specific protease, conserved site (IPR018200)

Experimentally confirmed subcellular location

cytoplasm (GO:0005737)

nucleus (GO:0005634)

Full-length cDNA

J033108F20 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0244300-01)

RiceXPro (AK121968)

Others

Oryzabase (22824)

KEGG (Os02t0244300-01)

Transcript

3460 bp

>Os02t0244300-01 Ubiquitin-specific protease, Deubiquitination enzyme, Positive regulation of grain width and size
GCCCATTCGCACACGAGACGACGCAGCGATCGAGCAGCGCAGCGCACAGTAGCAGCAGCA
GCAGCCGAGCGACTGAGCGAGCGAGAGAGCCCTACTCCGCCTCCGCCTCCGCCTCCGCCG
CCGCCGCTCGCCGCGGCGCCTCCCTCTCCGGCATTCCTTCGCCTGGTCAATCAGCAATTT
GGAATGATTTTTCAAGCTGAAGCAGAGAATTATCGAAGTTGGATGATAATATTCTGTTAG
GGACATGCTCCAACCAAGGGAATCCGATGTGCCTGTACTATTTGTTGTATTTATTGTACT
TCCGGTGATAGCTTATTTTCTTCTTGGAAGATGGCATGATGCTGTAAGTAAGAAGGCACG
GGTAAGTGTGCTGGCCCAGCGAGCTGCAGAAGAAACCTTCAAGGTGGAAACAATGGCGAC
TCCAGACGTTATATTGCCAGGACCTTCTTTAAGACCCATGCCTTATATGAGATCTGCACC
TTCTGCAAGACCCGAATACCATGAGTGTGCTACTTGCCACGGGCCTGCTAAGACTCGCTG
CTCCAGATGCAAGTCTGTTAGATACTGCTCTGGAAAGTGTCAAATAATTCACTGGAGGCA
AGGTCATAAGCAAACATGTCAGCAATGGAATGGTTTTGGTACTAGCAGCTCTGGTGGACT
ACCTCCTACTGAGAATACTGAACAGATGCCATTCTTAAGTAACCTGAACTCACCTCTTCG
AGGGAGCGATGTTCATCTGCATGACATGGATTTCGATACCATGTCAGAGCCATCCTTTGT
GACAACAGATAGCTATAATCTTGATACCAGCCCATTTCTGTCAGACCGAAGCAACATGAA
TAAACCAAACCAATTTCTACATACAAGTGAAAATGGTGCTGCCATTGGATCTTATGAGAA
GAACGACTATAGTATTGATGGAGAAGTCCCTTCTTCTGAGATTCTGTCAGGAAATAAGGG
TTTAAATAACAGTTCTGGTTCAGGTGAAAACTGCGGAAACCGTGATGTAATTTATCCTCT
CAATAGTGTGGTACATCAACCCAATAATTATGCCCCTGAAATAAGAAAGCGGCCCAAAGC
AAGCATCACGGTTTATGAATCTGATAAAGGCGTGTATTTAACTTCTGATATGATCAGTTC
TGGTGAGGGGCCATATGCTTCTGCTGCAGAGTCACTACAAAGAAGTAACTCGTCTGGAAA
TGTTACCGGAAAAGGAAACATGATACATAAGAAACCACCATACCCATCTGGTAAAGTGTC
ATCATCACAAAAATCACAGGAGAAGGTGTTGACATCACATCAATATGATGGGCATGAAAA
GAATCCCCACAACAAAAATGAGCAAAGATCTACCAAAACAGCTGTTTCAACAAACAGCAG
TTTGCAAGGATGCAATGGCATCTCAAAAGCAGGAGCATCAAAGGTTGAAGCCCTGAAGAA
GCCTTCAAAATTTCTCAAAACCAGTCTGGTGGGTTTGATCAATGATAACAAGAGGAGTAA
GGTACTGTTCCCATATGAAGATCTTGTTAAGTTTTTTCAGTATGAAGTACGGGGCATCTC
ACCTAGAGGTCTTTTCAATTGTGGAAATAGTTGCTATGCAAATGCTGTTCTACAATGTCT
CATGTGCACAAAACCCCTGATGATCTATCTGCTTCTGAGACTGCATTCCAAAGACTGTTG
CTCAAAGAATTGGTGCCTCATGTGTGAACTTGAGCAATATGCTTCAACTTTGCGTGAAAG
TGGTGGCCCTGTTTCTCCAAGTAGAATCCTTTCTAATCTGAGGAATATTGGATGTCGCTT
GGGTGGTGGAAGTCAAGAAGATGCTCATGAATTTTTAAGGCATCTTGTGATGTCTATGCA
AGGGGCATGCCTGGATGGACTTGGTGGTGAGAAGCAGGTAGAAGCAAGCTTGCAGGAAAC
TACACTGATACAGCAGATGTTTGGTGGCCGTCTTAAATCGAAGGTTAAGTGCCTCAGATG
CTACCATGAATCTGAAAGATACGAGAATATAATGGATCTTACTTTGGAGATTCATGGTTG
GGTCGAGTCCTTGCAAGATGCTTTGACACAATTCACTGCTCCTGAAGATTTGGATGGAGA
AAATATGTATAAATGTGGAAGGTGTTCTGCCTATGTCAAAGCTAGGAAACAATTAAGCGT
GCATGAGGTGCCAAATATATTAACTGTAGTTCTTAAAAGATTCCAGACAGGGAAATATGG
GAAGATCAACAAATGTGTTACTTTTCCTGATATGTTGGACATGGTTCCGTTTGTGACTGG
AGCTGGTGATAATCCTCCTCTTTACTTCTTGTATGCCGTGGTTGTACACGTGGATACAGA
AAATGCATCATTCTCTGGACATTACATATCATATGTCAAAGATATGCAGGGCACATGGTT
GAGAATTGATGATTCAGAGGTCCAGGCTGTTTCACTGAATCAAGTTATGTCAGAAGGTGC
ATATATGCTGTTCTACATGAGATCTTTTCCTCGCCCACCGAAGATTTACATTGAGAAGGG
CCTATCATCAGTTCCTACATGTTCAAAGCGCCATTCATCAAAATCCTCCAAGGGTTCTAA
GCAAGACCTGAATCATACTGAGTCACTCTTTGCTTCCAGTGATCAAACCTATGGAATATA
CGATTTCAGACCAGACAACGGCTATATACAAGATCAGCATGCTGCTTTGAGAACCAGAAA
TTTCTATCATACCGATGATGCTTTTGCAGATTCAATTAGCACAGACTTCTCAGATGCTAC
ATCAAGCGAATGGTCACTGTTTACCAGCTCTGATGAATCCTCATTTACGACTGAAAGCAC
TAGAGATTCATTCAGTGTTGTGGACTATGGTGACAATGCTGGCCTTGATCCAATTTCCTC
TATATTTGGGCCTTATTATGCTCAAGACCATCCTCCTGGCAGTTTTGCCTCGTGTACAAG
GTTGTCACCTTCCAATCCACAAACAAGGTACTTCCAAGAGAACACAGGCTTTGTCTCAGA
TTCTTCCATGCCGGCTCACCTGCCCGGCAATGTACATAGAGGAAGATATCCAGACAGGGC
CTGTTCTTCTTCAGCTGAACCTCCTGCTTCAGCAAATCCGCGAAGCGTATATGGTAGGTA
TGGCCTTAGTAGAGAAGGTTTTGTTCAAACATCTGGATTTTGTCAAATGTAATTGTCTAC
ATTTCATAGTTTTAGCTGGAGTTTGGCAGTTGTGGTTACCACTGCCATTAAATACCGCCT
CATGTTCTTTTATTTCAGATGAGGCATATTTAATTTTAGCTGCATATCCTAGGTTAGTTG
AGTGAGTGACTCAATGTAGCAGGCCAGCAGGGTAATTAGATTTGTCTAGGTGCCTAGCAT
TTCAGGAGATATATGTTAGAACACAGTGACAGGCTTTGTGCCATCCATTGTTCAACCAAA
AGCCAGTCATATCATTTATCTAGTTGCACAAAATTGTACC

CDS

2928 bp

>Os02t0244300-01 Ubiquitin-specific protease, Deubiquitination enzyme, Positive regulation of grain width and size
ATGCTCCAACCAAGGGAATCCGATGTGCCTGTACTATTTGTTGTATTTATTGTACTTCCG
GTGATAGCTTATTTTCTTCTTGGAAGATGGCATGATGCTGTAAGTAAGAAGGCACGGGTA
AGTGTGCTGGCCCAGCGAGCTGCAGAAGAAACCTTCAAGGTGGAAACAATGGCGACTCCA
GACGTTATATTGCCAGGACCTTCTTTAAGACCCATGCCTTATATGAGATCTGCACCTTCT
GCAAGACCCGAATACCATGAGTGTGCTACTTGCCACGGGCCTGCTAAGACTCGCTGCTCC
AGATGCAAGTCTGTTAGATACTGCTCTGGAAAGTGTCAAATAATTCACTGGAGGCAAGGT
CATAAGCAAACATGTCAGCAATGGAATGGTTTTGGTACTAGCAGCTCTGGTGGACTACCT
CCTACTGAGAATACTGAACAGATGCCATTCTTAAGTAACCTGAACTCACCTCTTCGAGGG
AGCGATGTTCATCTGCATGACATGGATTTCGATACCATGTCAGAGCCATCCTTTGTGACA
ACAGATAGCTATAATCTTGATACCAGCCCATTTCTGTCAGACCGAAGCAACATGAATAAA
CCAAACCAATTTCTACATACAAGTGAAAATGGTGCTGCCATTGGATCTTATGAGAAGAAC
GACTATAGTATTGATGGAGAAGTCCCTTCTTCTGAGATTCTGTCAGGAAATAAGGGTTTA
AATAACAGTTCTGGTTCAGGTGAAAACTGCGGAAACCGTGATGTAATTTATCCTCTCAAT
AGTGTGGTACATCAACCCAATAATTATGCCCCTGAAATAAGAAAGCGGCCCAAAGCAAGC
ATCACGGTTTATGAATCTGATAAAGGCGTGTATTTAACTTCTGATATGATCAGTTCTGGT
GAGGGGCCATATGCTTCTGCTGCAGAGTCACTACAAAGAAGTAACTCGTCTGGAAATGTT
ACCGGAAAAGGAAACATGATACATAAGAAACCACCATACCCATCTGGTAAAGTGTCATCA
TCACAAAAATCACAGGAGAAGGTGTTGACATCACATCAATATGATGGGCATGAAAAGAAT
CCCCACAACAAAAATGAGCAAAGATCTACCAAAACAGCTGTTTCAACAAACAGCAGTTTG
CAAGGATGCAATGGCATCTCAAAAGCAGGAGCATCAAAGGTTGAAGCCCTGAAGAAGCCT
TCAAAATTTCTCAAAACCAGTCTGGTGGGTTTGATCAATGATAACAAGAGGAGTAAGGTA
CTGTTCCCATATGAAGATCTTGTTAAGTTTTTTCAGTATGAAGTACGGGGCATCTCACCT
AGAGGTCTTTTCAATTGTGGAAATAGTTGCTATGCAAATGCTGTTCTACAATGTCTCATG
TGCACAAAACCCCTGATGATCTATCTGCTTCTGAGACTGCATTCCAAAGACTGTTGCTCA
AAGAATTGGTGCCTCATGTGTGAACTTGAGCAATATGCTTCAACTTTGCGTGAAAGTGGT
GGCCCTGTTTCTCCAAGTAGAATCCTTTCTAATCTGAGGAATATTGGATGTCGCTTGGGT
GGTGGAAGTCAAGAAGATGCTCATGAATTTTTAAGGCATCTTGTGATGTCTATGCAAGGG
GCATGCCTGGATGGACTTGGTGGTGAGAAGCAGGTAGAAGCAAGCTTGCAGGAAACTACA
CTGATACAGCAGATGTTTGGTGGCCGTCTTAAATCGAAGGTTAAGTGCCTCAGATGCTAC
CATGAATCTGAAAGATACGAGAATATAATGGATCTTACTTTGGAGATTCATGGTTGGGTC
GAGTCCTTGCAAGATGCTTTGACACAATTCACTGCTCCTGAAGATTTGGATGGAGAAAAT
ATGTATAAATGTGGAAGGTGTTCTGCCTATGTCAAAGCTAGGAAACAATTAAGCGTGCAT
GAGGTGCCAAATATATTAACTGTAGTTCTTAAAAGATTCCAGACAGGGAAATATGGGAAG
ATCAACAAATGTGTTACTTTTCCTGATATGTTGGACATGGTTCCGTTTGTGACTGGAGCT
GGTGATAATCCTCCTCTTTACTTCTTGTATGCCGTGGTTGTACACGTGGATACAGAAAAT
GCATCATTCTCTGGACATTACATATCATATGTCAAAGATATGCAGGGCACATGGTTGAGA
ATTGATGATTCAGAGGTCCAGGCTGTTTCACTGAATCAAGTTATGTCAGAAGGTGCATAT
ATGCTGTTCTACATGAGATCTTTTCCTCGCCCACCGAAGATTTACATTGAGAAGGGCCTA
TCATCAGTTCCTACATGTTCAAAGCGCCATTCATCAAAATCCTCCAAGGGTTCTAAGCAA
GACCTGAATCATACTGAGTCACTCTTTGCTTCCAGTGATCAAACCTATGGAATATACGAT
TTCAGACCAGACAACGGCTATATACAAGATCAGCATGCTGCTTTGAGAACCAGAAATTTC
TATCATACCGATGATGCTTTTGCAGATTCAATTAGCACAGACTTCTCAGATGCTACATCA
AGCGAATGGTCACTGTTTACCAGCTCTGATGAATCCTCATTTACGACTGAAAGCACTAGA
GATTCATTCAGTGTTGTGGACTATGGTGACAATGCTGGCCTTGATCCAATTTCCTCTATA
TTTGGGCCTTATTATGCTCAAGACCATCCTCCTGGCAGTTTTGCCTCGTGTACAAGGTTG
TCACCTTCCAATCCACAAACAAGGTACTTCCAAGAGAACACAGGCTTTGTCTCAGATTCT
TCCATGCCGGCTCACCTGCCCGGCAATGTACATAGAGGAAGATATCCAGACAGGGCCTGT
TCTTCTTCAGCTGAACCTCCTGCTTCAGCAAATCCGCGAAGCGTATATGGTAGGTATGGC
CTTAGTAGAGAAGGTTTTGTTCAAACATCTGGATTTTGTCAAATGTAA

Protein

976 aa

>Os02t0244300-01 Ubiquitin-specific protease, Deubiquitination enzyme, Positive regulation of grain width and size
MLQPRESDVPVLFVVFIVLPVIAYFLLGRWHDAVSKKARVSVLAQRAAEETFKVETMATP
DVILPGPSLRPMPYMRSAPSARPEYHECATCHGPAKTRCSRCKSVRYCSGKCQIIHWRQG
HKQTCQQWNGFGTSSSGGLPPTENTEQMPFLSNLNSPLRGSDVHLHDMDFDTMSEPSFVT
TDSYNLDTSPFLSDRSNMNKPNQFLHTSENGAAIGSYEKNDYSIDGEVPSSEILSGNKGL
NNSSGSGENCGNRDVIYPLNSVVHQPNNYAPEIRKRPKASITVYESDKGVYLTSDMISSG
EGPYASAAESLQRSNSSGNVTGKGNMIHKKPPYPSGKVSSSQKSQEKVLTSHQYDGHEKN
PHNKNEQRSTKTAVSTNSSLQGCNGISKAGASKVEALKKPSKFLKTSLVGLINDNKRSKV
LFPYEDLVKFFQYEVRGISPRGLFNCGNSCYANAVLQCLMCTKPLMIYLLLRLHSKDCCS
KNWCLMCELEQYASTLRESGGPVSPSRILSNLRNIGCRLGGGSQEDAHEFLRHLVMSMQG
ACLDGLGGEKQVEASLQETTLIQQMFGGRLKSKVKCLRCYHESERYENIMDLTLEIHGWV
ESLQDALTQFTAPEDLDGENMYKCGRCSAYVKARKQLSVHEVPNILTVVLKRFQTGKYGK
INKCVTFPDMLDMVPFVTGAGDNPPLYFLYAVVVHVDTENASFSGHYISYVKDMQGTWLR
IDDSEVQAVSLNQVMSEGAYMLFYMRSFPRPPKIYIEKGLSSVPTCSKRHSSKSSKGSKQ
DLNHTESLFASSDQTYGIYDFRPDNGYIQDQHAALRTRNFYHTDDAFADSISTDFSDATS
SEWSLFTSSDESSFTTESTRDSFSVVDYGDNAGLDPISSIFGPYYAQDHPPGSFASCTRL
SPSNPQTRYFQENTGFVSDSSMPAHLPGNVHRGRYPDRACSSSAEPPASANPRSVYGRYG
LSREGFVQTSGFCQM*

5'UTR

chr02:8135122..8135269 (+ strand) : 148 bp

chr02:8135405..8135421 (+ strand) : 17 bp

chr02:8136295..8136373 (+ strand) : 79 bp

CDS

chr02:8136374..8136696 (+ strand) : 323 bp

chr02:8137068..8137458 (+ strand) : 391 bp

chr02:8137541..8137928 (+ strand) : 388 bp

chr02:8138018..8138172 (+ strand) : 155 bp

chr02:8138264..8138352 (+ strand) : 89 bp

chr02:8138524..8138609 (+ strand) : 86 bp

chr02:8138706..8138868 (+ strand) : 163 bp

chr02:8139947..8140070 (+ strand) : 124 bp

chr02:8140325..8140482 (+ strand) : 158 bp

chr02:8140574..8140658 (+ strand) : 85 bp

chr02:8140995..8141207 (+ strand) : 213 bp

chr02:8142215..8142276 (+ strand) : 62 bp

chr02:8142367..8143057 (+ strand) : 691 bp

3'UTR

chr02:8143058..8143345 (+ strand) : 288 bp

FASTA

>Os02t0244300-01 class=Sequence position=chr02:8135122..8143345 (+ strand)
GCCCATTCGC ACACGAGACG ACGCAGCGAT CGAGCAGCGC AGCGCACAGT AGCAGCAGCA GCAGCCGAGC GACTGAGCGA
GCGAGAGAGC CCTACTCCGC CTCCGCCTCC GCCTCCGCCG CCGCCGCTCG CCGCGGCGCC TCCCTCTCCG GCCGCCGCCG
CCGCCGCCGC CTGCAGCGCC GTTCGCGTGG GCGCCTCTCG ATCTCTCGAG GAAAAAAGCG GGGAGGCGCG GGCGCTGCCG
CGTCCCTTTT TGCTGCCCGG AGATCCGCCC CGGGGTGGGG CGGCGGCATT CCTTCGCCTG GTAAAACCCT AGACTCCCTT
CGATTCGGGT TCCCCCTTTG CCTCGCGCCG CGGAGGAATC GGGCGTTTTC TGCGGCGGGG GTTCCGCTCG GTCCGGGGGC
TCCTTGCGCG GGCGGTGTTA ATCCGTTTGC TCGCTGGGTC GGGGTGGGTG GGGGTGGGTT CGTGCGCCGA CACCTGTAGC
GGGGGCGCCC GCGTGTGGGG GGAATTTGGG CGTGGGGGAG TTCGCCTCCC CCTGCGTGGT TGGGATCTGG GGGATTGTAG
ATTTCCTCAT TCTTTTGTTA GGCTAGAGAA CTGGTAGTAC TATTTTGGCA TTGATGTGGT CAATGTGGTG CGCGCGAGTT
AGGTCTTATG CAACAGGATG TTTGTGGGGA GATATGGGCG GAATGTATTG CATAAGATTG TGGATGGATT TCAGCGCTTT
GCATGAATGT TTGGGAATGT AATGATACGT TTCAGGTATT CTAATGCCTT CTTGGCTAGA AATTTTGGGT ATATTACAGT
GAAGATGTGA CTCTACCAAC TTGTCCTTTT TTGGGTGGGT TTGAGTATTT AGCCATTCAC AGATAATTTT TGTTTCCACC
AGTATGGTAG TGTCTGGTAT AGCTTCAGCT TATGTGCTTG TAAGCTCATG TCGTCATTCT GAAGCTACCA TAAAACCTTT
TTGCGCCCTG GAAACGCCAA TCAAGCTTTG GCCTGAGAGA TCGATCTTCT AATGCATATA AATGAGGCCC CAATAGCTTG
TTTGTCAAGA AGCTTAATGT TCTCATAGCC CCTAAATCTT TGAATGGTTT ATGTTATGAT TGTCATTTTC CACTTTCGTG
ATAGTGCAAA GTGGAAAACT CTAAACTTAA TTTTTGTTAT GCTGCTTCCG TAGGTCAATC AGCAATTTGG AATGATTTTT
CAAGCTGAAG CAGAGAATTA TCGAAGTTGG ATGATAATAT TCTGTTAGGG ACATGCTCCA ACCAAGGGAA TCCGATGTGC
CTGTACTATT TGTTGTATTT ATTGTACTTC CGGTGATAGC TTATTTTCTT CTTGGAAGAT GGCATGATGC TGTAAGTAAG
AAGGCACGGG TAAGTGTGCT GGCCCAGCGA GCTGCAGAAG AAACCTTCAA GGTGGAAACA ATGGCGACTC CAGACGTTAT
ATTGCCAGGA CCTTCTTTAA GACCCATGCC TTATATGAGA TCTGCACCTT CTGCAAGACC CGAATACCAT GAGTGTGCTA
CTTGCCACGG GCCTGCTAAG ACTCGCTGCT CCAGATGCAA GTCTGTTAGA TACTGGTAAG ATACTCTGTT TCTCTTCTCC
ATCATGTGCT GTCTATTCAT TATAATCAAT CTGTGTACCA AATAAACTGT GCCCCTCGCA TGCTATTGAG TATTGAAATA
TGGTAACTAT TACTCTTTTA TGTCCTTAAT AGTACCGTAG TAGGTATTTG GAAGTGGCAA TTTGACTGTA TATGACTATA
GCAATTCTGA TAACCTTAAC AGCTGGTATT TAAAAAAAAA AAGCTAAATT CAGTATTTGC CACTCCTCAA GTTGCCCTTG
CACCACATCT CTCTCTATCA TGTAGCCTAT CCACATCTCT CTCTATCATG TAGCCTATCT GATTGTGTTA ATTAATGTAC
ATATTATGAC TTTTGATGTT CAACAGCTCT GGAAAGTGTC AAATAATTCA CTGGAGGCAA GGTCATAAGC AAACATGTCA
GCAATGGAAT GGTTTTGGTA CTAGCAGCTC TGGTGGACTA CCTCCTACTG AGAATACTGA ACAGATGCCA TTCTTAAGTA
ACCTGAACTC ACCTCTTCGA GGGAGCGATG TTCATCTGCA TGACATGGAT TTCGATACCA TGTCAGAGCC ATCCTTTGTG
ACAACAGATA GCTATAATCT TGATACCAGC CCATTTCTGT CAGACCGAAG CAACATGAAT AAACCAAACC AATTTCTACA
TACAAGTGAA AATGGTGCTG CCATTGGATC TTATGAGAAG AACGACTATA GTATTGATGG AGAAGTCCCT TCTTCTGAGA
TTCTGTCAGG AAATAAGGTA GCTTAGCCAA GCTCTTAACT ACAATTTTCT TTTACAAGAT TTGTTTTAAG TAATCCAATC
CATTACATTA TCTTTTCAGG GTTTAAATAA CAGTTCTGGT TCAGGTGAAA ACTGCGGAAA CCGTGATGTA ATTTATCCTC
TCAATAGTGT GGTACATCAA CCCAATAATT ATGCCCCTGA AATAAGAAAG CGGCCCAAAG CAAGCATCAC GGTTTATGAA
TCTGATAAAG GCGTGTATTT AACTTCTGAT ATGATCAGTT CTGGTGAGGG GCCATATGCT TCTGCTGCAG AGTCACTACA
AAGAAGTAAC TCGTCTGGAA ATGTTACCGG AAAAGGAAAC ATGATACATA AGAAACCACC ATACCCATCT GGTAAAGTGT
CATCATCACA AAAATCACAG GAGAAGGTGT TGACATCACA TCAATATGAT GGGCATGAAA AGAATCCCCA CAACAAAAAT
GAGCAAAGTT AGTGCATAAT TTCTTTATTG GATAAAATGG CCTTGCTTTG TCATATGGTT ACTTCGTTGA TCTCATATAT
TTACTACATT TTGCAGGATC TACCAAAACA GCTGTTTCAA CAAACAGCAG TTTGCAAGGA TGCAATGGCA TCTCAAAAGC
AGGAGCATCA AAGGTTGAAG CCCTGAAGAA GCCTTCAAAA TTTCTCAAAA CCAGTCTGGT GGGTTTGATC AATGATAACA
AGAGGAGTAA GGTTTGAATC ATCCACAATA TATCTCGAGT TAGTTATTTC AGAGTTTCTG TATCAAAATG CTGAGGGTAT
TGTTTCTAAA TTGACACTTC AGGTACTGTT CCCATATGAA GATCTTGTTA AGTTTTTTCA GTATGAAGTA CGGGGCATCT
CACCTAGAGG TCTTTTCAAT TGTGGAAATA GGTACTTAAC ATTGTTCATT GAGTGTTCAT TGTAATGAGT TCTGCAAATA
ACAGAACCTA AGAATCTTAA CAGAAAATAT GACTCTTGTT TCTTCCATTC TCATCTCCAT GTTCTAAACA ATTGTTTGTT
CGCATGTCAC TATCTGATTG TTATTGCTCC TTTTTTTTGC AGTTGCTATG CAAATGCTGT TCTACAATGT CTCATGTGCA
CAAAACCCCT GATGATCTAT CTGCTTCTGA GACTGCATTC CAAAGACTGT AATACCAAAA CTCAAGCCCC CACCCTCCTT
GGTGTAGTTG TGAAATCTCT CACCATCTCT GATTTCTTTG ACATTGATTG CTTTATTCTT TTAGGTTGCT CAAAGAATTG
GTGCCTCATG TGTGAACTTG AGCAATATGC TTCAACTTTG CGTGAAAGTG GTGGCCCTGT TTCTCCAAGT AGAATCCTTT
CTAATCTGAG GAATATTGGA TGTCGCTTGG GTGGTGGAAG TCAAGAAGAT GCTCATGAAT TTTTAAGGTG CTGTAACTGT
TACATGCTAC TTCTAGTTTT CATTTGTGAT TGCTTGCTAC CTTTTTTAGG TTGTTCTAGT GATAAGATAA CTTCAGTAGA
AGTGGGAGTA ATGCTTAGGA AACCCTGCCA AAACTTCTAT TCCACATTAT TGCTTCATCA CTATCAAAAT TTATTGAAAT
ATTTCCTCAT GTAAGAGAAG CAATTTTTGC ATACACCTAT CCTGGAGCTA AAAGGAATCG TTGCTATTTG GGGTATGCAA
AATAAAAGGG CGAACAAATG CGAAGAACCA TGACTCGGAG GGTTCCTTTT TCTTATTTGA ACATGGCCAG TCAGAAGTTA
ATGAAATTTC TCGACTAACT TGAAATTGAT CTAAAAAGTT CCAAATCTGT TTTTTCTTAT GGCCTATTTT GCTTCTGATG
ATTATATCTT TTTCTTTAAA AAAGAAAGAT TATATCTATT GTTGACTTGT ACTTTAGCAT AGCTACCTAG TTATTATTTG
CCACATAAAT GGTTTTTTGG CATGGTAATG TGGGGTTGAG AGAAGCGGCC ACTGATGCTA GTATAACCAT TTACTATTTC
TTGCTCTAGC CAAAAAATAA AAAATAAAAA TCCATAATAG TATGTGCAAT GGAACTTCAT CTGTTGATAT TGTTGATCAC
ATTTACGCGC GCACACACAC ACACACACAC TGGTGTGCTT CAGTTGAAAT TTCGTGAAGT TCACATATTT GTCCCTAGCC
TTCTTTGATT GGACATGTAT TAAGGGGTGC ACTCAGGGTG TGCATGTGTG TTTGAGTTTT CTATGTAACA GGAGAGAAAA
AAAAAGGAAT TTCTCCCATT GTCCAAGTGA ATAATTGATT ACTGTCTCCC TTAAGGCTGT AATCTGGAAC TGTAATGCAC
TAATGTATCT GAATATTTGA GTTTTAATGT GTCCTTTTCT AAGAACCTCA TGCTCCAGTA TGTTCACGCT CTATGAAATA
GATTAATGAA AAAGGGAAAT TATAATTGAA GTATTTGGAA TCTGAAAAGA GTTCCATTAT TTGTGACCAT GCACTCACAT
TATCCTTGAT TTGCTAAATT ACCAGGCATC TTGTGATGTC TATGCAAGGG GCATGCCTGG ATGGACTTGG TGGTGAGAAG
CAGGTAGAAG CAAGCTTGCA GGAAACTACA CTGATACAGC AGATGTTTGG TGGCCGTCTT AAATCGAAGG TAACTTAATA
AATTGCTGAC TTCTCAGGTG TAATTTTGAA GATAGCTGCT AGTTTGTTCA GTGTCGTACT GTTTGTTATC CTGTGTAGTT
GCTGTGAATA TGTTTTCCCC ACTTGTAAAA AGATGCAGTT TTTCCCCACT TGTAAAAAGA TGCAGTTTTG TCACTTAAGA
TTTCTCCTCT TCATGTCAAT TATCTTACTA GTTGGCTGTT CATTGTGTTT TACTATGCTA ACTGATTTAG TTAATGAAAC
TAGGTTAAGT GCCTCAGATG CTACCATGAA TCTGAAAGAT ACGAGAATAT AATGGATCTT ACTTTGGAGA TTCATGGTTG
GGTCGAGTCC TTGCAAGATG CTTTGACACA ATTCACTGCT CCTGAAGATT TGGATGGAGA AAATATGTAT AAATGTGGAA
GGTACTGTTG CAACTAATAT ATTTATCCAT CATTTCCATT GGATCACACC ATCACAACAT ATTGAACTTA TCTTTTAATT
CTTTTAATGC AGGTGTTCTG CCTATGTCAA AGCTAGGAAA CAATTAAGCG TGCATGAGGT GCCAAATATA TTAACTGTAG
TTCTTAAAAG ATTCCAGGTA CTATTTGATT TCACGCCATA TTGATAAATT CCCAGTAATT GCTTATACCA GGTCTACTGT
TTAGCTAGAT ATTGGAAGCA TTTTCTTGCA CATTTATGCA GTACTGTAGT TTGCATGCGA TATTTGCGTA ACTATTTGAT
AACATCCAGT TAAAAACGAC TAATTTCTAT TATATGATGT AAGCACATTT CGGGAAAAAT TGAAGCATAC AATTCGTTAG
CTGGATCACT TGATATACGA ATTACATTGG CCTATTTAGC TACTCTGAAG AGACGCTGTT GCATAATTTT CCCCTCAATA
TGATGAAATT AAGTGAATAT TTTATTGCTC CAGACAGGGA AATATGGGAA GATCAACAAA TGTGTTACTT TTCCTGATAT
GTTGGACATG GTTCCGTTTG TGACTGGAGC TGGTGATAAT CCTCCTCTTT ACTTCTTGTA TGCCGTGGTT GTACACGTGG
ATACAGAAAA TGCATCATTC TCTGGACATT ACATATCATA TGTCAAAGAT ATGCAGGGCA CATGGTTGAG AATTGATGAT
TCAGAGGTAT GTGATACAAA AATGTGAAGA AATGTGGTTC TGATGATTCC TTATTTAAAT TAAGAACCTG TTTAGGTGTT
GCTTTAAGAA ATTACTTATG AGTTTGGACC CTATAGAACT GCATATGTCT AGATTTATTA TGGTATCATG AGATTATCTT
CCAGTGGGCC ATAATATACT CTGTACTCTG TTTCTCCTAA TGCAGTTATG GTGTTAACTT AAACTATATA TTCAATTATG
TTTGCCCTTG TCCTTTTAAT TTTCAAGTTC AGTTTTTATC CATCCATATA TCTATAAAAA AATCACTCCC TCCAGTCACA
AAAGGACACT GTTTTTGACT TTTCAAATTA AAcaatgcat aactttgact acttaattat gctgcataaa tcttgaaaag
ttattcaagt gtaatattat gaaaagtacg acgaacttga gtacatcatt tttcatatgc tcaaaACCTA CATTTTAAAC
AATACTTACG GTCAAATTTA ACTTGCTTTG ACCGTACCTA TCCTAAAAAA GACATTCTTT TGACTGGAGA GAGTATTTGT
ACAAAGAACA AATGTTATAT CATATGCTGT GTTTTTTTTT AGAACCATTT GAAAGTATAT GCTCACAAAT TATGCTTTAT
GTGTCCAAAC TATCTTACTG TATGGGATAA GGACAGGCAA CTTTCAATTT CTAGGTGTTC AATGACTATA ATAAAATTTC
AATACCAGTA CATTACTATT AAAAGATGTG ACAGATGTAC TAGTCTATTT GATATAACTA GATTGGTAAA AATGCACTAT
TAGGATCTTG GACTATGGTA TATGATTGCA CAGTACGATC CTATGGGAGC ATCTTTGATT CAACTGGAAA TTCTGATCCT
CACAAAGAGT GCTTTGTGTC GAGAATTTCA TGTCTTTTTA GCATGTGATA TCACGTTTCT TAGGAGGCTG CTATATGTGC
ATTTGAAAAT CTGAAAATCA AATGAGCTGA TATGATAATT TGGATGAATG TAGGTCCAGG CTGTTTCACT GAATCAAGTT
ATGTCAGAAG GTGCATATAT GCTGTTCTAC ATGAGGTATA TACGAACTGT GATGTCTGTG GTATCTATAT TATCAGATAA
AATTGTTCTG TGCCTGTAGC AAACTCATAT TTATGTAACC TTCAGATCTT TTCCTCGCCC ACCGAAGATT TACATTGAGA
AGGGCCTATC ATCAGTTCCT ACATGTTCAA AGCGCCATTC ATCAAAATCC TCCAAGGGTT CTAAGCAAGA CCTGAATCAT
ACTGAGTCAC TCTTTGCTTC CAGTGATCAA ACCTATGGAA TATACGATTT CAGACCAGAC AACGGCTATA TACAAGATCA
GCATGCTGCT TTGAGAACCA GAAATTTCTA TCATACCGAT GATGCTTTTG CAGATTCAAT TAGCACAGAC TTCTCAGATG
CTACATCAAG CGAATGGTCA CTGTTTACCA GCTCTGATGA ATCCTCATTT ACGACTGAAA GCACTAGAGA TTCATTCAGT
GTTGTGGACT ATGGTGACAA TGCTGGCCTT GATCCAATTT CCTCTATATT TGGGCCTTAT TATGCTCAAG ACCATCCTCC
TGGCAGTTTT GCCTCGTGTA CAAGGTTGTC ACCTTCCAAT CCACAAACAA GGTACTTCCA AGAGAACACA GGCTTTGTCT
CAGATTCTTC CATGCCGGCT CACCTGCCCG GCAATGTACA TAGAGGAAGA TATCCAGACA GGGCCTGTTC TTCTTCAGCT
GAACCTCCTG CTTCAGCAAA TCCGCGAAGC GTATATGGTA GGTATGGCCT TAGTAGAGAA GGTTTTGTTC AAACATCTGG
ATTTTGTCAA ATGTAATTGT CTACATTTCA TAGTTTTAGC TGGAGTTTGG CAGTTGTGGT TACCACTGCC ATTAAATACC
GCCTCATGTT CTTTTATTTC AGATGAGGCA TATTTAATTT TAGCTGCATA TCCTAGGTTA GTTGAGTGAG TGACTCAATG
TAGCAGGCCA GCAGGGTAAT TAGATTTGTC TAGGTGCCTA GCATTTCAGG AGATATATGT TAGAACACAG TGACAGGCTT
TGTGCCATCC ATTGTTCAAC CAAAAGCCAG TCATATCATT TATCTAGTTG CACAAAATTG TACC

Locus: Os02g0244300

Loading...

Locus: Os02g0244300

Loading...