Os02t0244700-03

Locus

Os02g0244700

Description

Similar to Phosphoenolpyruvate carboxylase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

PEPC-1, Osppc1, ppc1

Oryzabase Gene Name Synonym(s)

PEP carboxylase 1, Phosphoenolpyruvate carboxylase 1, PEPCase 1

Transcript Evidence

AK106451 (DDBJ, Best hit)

Protein Evidence

Q9FYX8 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: tricarboxylic acid cycle (GO:0006099)

Biological Process: carbon fixation (GO:0015977)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: phosphoenolpyruvate carboxylase activity (GO:0008964)

Functional domain (InterPro)

Pyruvate/Phosphoenolpyruvate kinase (IPR015813)

Phosphoenolpyruvate carboxylase, active site (IPR018129)

Phosphoenolpyruvate carboxylase (IPR021135)

Full-length cDNA

002-103-F01 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0244700-03)

RiceXPro (AK106451)

Others

Oryzabase (11419)

KEGG (Os02t0244700-03 (EC:4.1.1.31))

Transcript

1541 bp

>Os02t0244700-03 Similar to Phosphoenolpyruvate carboxylase.
ACACCCACACTCTCTACCCCCAAACTTGCCCTCCAATCTATCTCCGCCGCCGCCGCCGCC
TCCGCCGCGAGAGGGCGTCGCCGAGCTGCGCGGGAGGCTCGCCTCCCGCAGCATCTGGCC
GGATTCGTCGTAGTCGAGGCAGCTGTAAGCGAGAGAGAGGGAGATGGCCGCGGCCGCCGG
GAAGGCGGCGATGGAGCGGCACCAGTCGATCGACGCGCAGCTGCGGCTGCTCGCGCCGGG
GAAGGTATCCGAGGACGACAAGCTCGTCGAGTACGACGCCCTCCTCGTCGACCGCTTCCT
CGACATCCTCCAGGACCTGCACGGCCCTCACCTCCGCGAATTCGTGCAGGAGTGCTACGA
GCTGTCGGCGGAGTACGAGAACGACAGGGACGAGGCGCGGCTCGACGAGCTGGGGAGGAA
GCTCACCAGCCTGCCGCCGGGGGACTCCATCGTCGTCTCCAGCTCCTTCTCGCACATGCT
CAACCTCGCCAACCTCGCCGAGGAGGTGCAGATCGCGCACCGCCGCCGGATCAAGCTCAA
GCGCGGGGACTTCGCCGACGAGGCCTCCGCGCCCACCGAGTCCGACATCGAGGAGACGCT
CAAGCGCCTCGTCACCCAGCTCGGCAAGTCGAGGGAGGAGGTGTTCGATGCGCTCAAGAA
CCAGACCGTTGACCTCGTGTTCACCGCGCATCCAACGCAGTCCGTCAGGAGGTCCCTGCT
CCAGAAGCACGGGAGGATCCGGAATTGCCTGAGGCAGTTATATGCGAAAGACATCACTGC
TGATGACAAGCAGGAGCTTGATGAGGCCCTGCAGAGGGAGATTCAAGCAGCTTTCAGAAC
TGATGAAATCCGCAGGACTCCTCCCACTCCTCAGGATGAAATGCGCGCCGGGATGAGTTA
TTTTCATGAAACTATATGGAAGGGTGTACCAAAGTTCTTGCGCCGCATTGATACTGCTCT
GAAAAATATTGGGATTAATGAGCGTCTTCCTTACAATGCTCCTCTCATCCAGTTCTCATC
CTGGATGGGTGGTGACCGTGATGGAAACCCAAGAGTTACACCAGAGGTTACAAGAGATGT
ATGCTTGTTGGCAAGAATGATGGCTGCTAACCTGTACTTCTCTCAGATAGAAGATCTGAT
GTTTGAGCTCTCTATGTGGCGCTGCAGTGATGAACTTCGAATTCGTGCAGATGATTTGCA
TTGCTCCTCCAGAAAAGCTGCAAAGCACTATATAGAATTCTGGAAGCAAATTCCTCCAAA
TGAGCCTTATCGTGTCATACTTGGTGGTGTCAGGGATAAATTGTACTATACGCGTGAACG
TACTCGCCATCTATTGACAACTGGAGTTTCTGAAATTCCAGAGGAGGCAACGTTTACTAA
TGTTGAAGAGTTTCTGGAGCCGCTTGAGCTGTGCTACAGATCATTATGTGCTTGTGGTGA
CAAACCTATAGCTGATGGAAGCCTTCTTGATGTAAATGTCAAGGGGGGACTTATTTGGCT
TTTGCAGCCCGATCCAAAATAAAATATGGACCAATCATTCT

CDS

1359 bp

>Os02t0244700-03 Similar to Phosphoenolpyruvate carboxylase.
ATGGCCGCGGCCGCCGGGAAGGCGGCGATGGAGCGGCACCAGTCGATCGACGCGCAGCTG
CGGCTGCTCGCGCCGGGGAAGGTATCCGAGGACGACAAGCTCGTCGAGTACGACGCCCTC
CTCGTCGACCGCTTCCTCGACATCCTCCAGGACCTGCACGGCCCTCACCTCCGCGAATTC
GTGCAGGAGTGCTACGAGCTGTCGGCGGAGTACGAGAACGACAGGGACGAGGCGCGGCTC
GACGAGCTGGGGAGGAAGCTCACCAGCCTGCCGCCGGGGGACTCCATCGTCGTCTCCAGC
TCCTTCTCGCACATGCTCAACCTCGCCAACCTCGCCGAGGAGGTGCAGATCGCGCACCGC
CGCCGGATCAAGCTCAAGCGCGGGGACTTCGCCGACGAGGCCTCCGCGCCCACCGAGTCC
GACATCGAGGAGACGCTCAAGCGCCTCGTCACCCAGCTCGGCAAGTCGAGGGAGGAGGTG
TTCGATGCGCTCAAGAACCAGACCGTTGACCTCGTGTTCACCGCGCATCCAACGCAGTCC
GTCAGGAGGTCCCTGCTCCAGAAGCACGGGAGGATCCGGAATTGCCTGAGGCAGTTATAT
GCGAAAGACATCACTGCTGATGACAAGCAGGAGCTTGATGAGGCCCTGCAGAGGGAGATT
CAAGCAGCTTTCAGAACTGATGAAATCCGCAGGACTCCTCCCACTCCTCAGGATGAAATG
CGCGCCGGGATGAGTTATTTTCATGAAACTATATGGAAGGGTGTACCAAAGTTCTTGCGC
CGCATTGATACTGCTCTGAAAAATATTGGGATTAATGAGCGTCTTCCTTACAATGCTCCT
CTCATCCAGTTCTCATCCTGGATGGGTGGTGACCGTGATGGAAACCCAAGAGTTACACCA
GAGGTTACAAGAGATGTATGCTTGTTGGCAAGAATGATGGCTGCTAACCTGTACTTCTCT
CAGATAGAAGATCTGATGTTTGAGCTCTCTATGTGGCGCTGCAGTGATGAACTTCGAATT
CGTGCAGATGATTTGCATTGCTCCTCCAGAAAAGCTGCAAAGCACTATATAGAATTCTGG
AAGCAAATTCCTCCAAATGAGCCTTATCGTGTCATACTTGGTGGTGTCAGGGATAAATTG
TACTATACGCGTGAACGTACTCGCCATCTATTGACAACTGGAGTTTCTGAAATTCCAGAG
GAGGCAACGTTTACTAATGTTGAAGAGTTTCTGGAGCCGCTTGAGCTGTGCTACAGATCA
TTATGTGCTTGTGGTGACAAACCTATAGCTGATGGAAGCCTTCTTGATGTAAATGTCAAG
GGGGGACTTATTTGGCTTTTGCAGCCCGATCCAAAATAA

Protein

453 aa

>Os02t0244700-03 Similar to Phosphoenolpyruvate carboxylase.
MAAAAGKAAMERHQSIDAQLRLLAPGKVSEDDKLVEYDALLVDRFLDILQDLHGPHLREF
VQECYELSAEYENDRDEARLDELGRKLTSLPPGDSIVVSSSFSHMLNLANLAEEVQIAHR
RRIKLKRGDFADEASAPTESDIEETLKRLVTQLGKSREEVFDALKNQTVDLVFTAHPTQS
VRRSLLQKHGRIRNCLRQLYAKDITADDKQELDEALQREIQAAFRTDEIRRTPPTPQDEM
RAGMSYFHETIWKGVPKFLRRIDTALKNIGINERLPYNAPLIQFSSWMGGDRDGNPRVTP
EVTRDVCLLARMMAANLYFSQIEDLMFELSMWRCSDELRIRADDLHCSSRKAAKHYIEFW
KQIPPNEPYRVILGGVRDKLYYTRERTRHLLTTGVSEIPEEATFTNVEEFLEPLELCYRS
LCACGDKPIADGSLLDVNVKGGLIWLLQPDPK*

5'UTR

chr02:8183999..8184161 (- strand) : 163 bp

CDS

chr02:8183819..8183998 (- strand) : 180 bp

chr02:8183326..8183717 (- strand) : 392 bp

chr02:8183152..8183236 (- strand) : 85 bp

chr02:8182228..8182450 (- strand) : 223 bp

chr02:8181802..8181905 (- strand) : 104 bp

chr02:8181626..8181713 (- strand) : 88 bp

chr02:8180700..8180854 (- strand) : 155 bp

chr02:8180536..8180616 (- strand) : 81 bp

chr02:8177842..8177892 (- strand) : 51 bp

3'UTR

chr02:8177823..8177841 (- strand) : 19 bp

FASTA

>Os02t0244700-03 class=Sequence position=chr02:8177823..8184161 (- strand)
ACACCCACAC TCTCTACCCC CAAACTTGCC CTCCAATCTA TCTCCGCCGC CGCCGCCGCC TCCGCCGCGA GAGGGCGTCG
CCGAGCTGCG CGGGAGGCTC GCCTCCCGCA GCATCTGGCC GGATTCGTCG TAGTCGAGGC AGCTGTAAGC GAGAGAGAGG
GAGATGGCCG CGGCCGCCGG GAAGGCGGCG ATGGAGCGGC ACCAGTCGAT CGACGCGCAG CTGCGGCTGC TCGCGCCGGG
GAAGGTATCC GAGGACGACA AGCTCGTCGA GTACGACGCC CTCCTCGTCG ACCGCTTCCT CGACATCCTC CAGGACCTGC
ACGGCCCTCA CCTCCGCGAA TTCGTAACTT ACTTGCTTCC CAGATCCTGT TGCTCGTGCC CGCCACCTGT TCGATCGATT
GCCCACACGG TTGGTTGGCT TTGGTTTTGG TTCTCTTCTT GCAGGTGCAG GAGTGCTACG AGCTGTCGGC GGAGTACGAG
AACGACAGGG ACGAGGCGCG GCTCGACGAG CTGGGGAGGA AGCTCACCAG CCTGCCGCCG GGGGACTCCA TCGTCGTCTC
CAGCTCCTTC TCGCACATGC TCAACCTCGC CAACCTCGCC GAGGAGGTGC AGATCGCGCA CCGCCGCCGG ATCAAGCTCA
AGCGCGGGGA CTTCGCCGAC GAGGCCTCCG CGCCCACCGA GTCCGACATC GAGGAGACGC TCAAGCGCCT CGTCACCCAG
CTCGGCAAGT CGAGGGAGGA GGTGTTCGAT GCGCTCAAGA ACCAGACCGT TGACCTCGTG TTCACCGCGC ATCCAACGCA
GTCCGTCAGG AGGTCCCTGC TCCAGAAGCA CGGGAGGTGC GTCGATGAGC TGTCCCCTTC TCCGATGCTC TCGGTGCGTC
GGGAAATGCT AAATCTAATG CTCTTGATGT TGACTCGCTG TGCAGGATCC GGAATTGCCT GAGGCAGTTA TATGCGAAAG
ACATCACTGC TGATGACAAG CAGGAGCTTG ATGAGGCCCT GCAGAGGGAG GTAAGTTGAT TTTTTTTTTT GTCAATTTGT
GGTTACAATA TTATAAAGTC AATCATAGCA AAAGTGTCCA CCGCACCATT TTGATTATTT TACTGCTTAT CAGCTCAATG
GCTTCTTTTT CTTGATGACT TAAATTATGG GTCTCTGGGC TTAATGAGAT TTGTATACTC TCAGGCAGTA GCTTAATTTA
GAATTAGGTC CATCCTAAAA GCTTAATTTA GTCGAAGTGG CAAATCATGT TTGTGCCTCT TTTATCTATG TGGTGCCTGT
CCTGCTCCAT GATCTTGCCA AATAATTTAG AAATCTTATC TCTATTGTCT GTACACCATT CTTTTATATT AGTTTATTTG
GACAAGGATT TTTTTTTTTA CATTAGTTTA GTTGGAGACA AGGAAAAACA TTGAACACTA GGTGATTATT TCCAGATCCT
CAAAAGGTGT TTACCTATCA CGTTCATAAA TTAATTGCTC TGTACTTTTG GACTCTGTCT TGACAGTTCT GAAGTCCATC
TCCAATAGTT TTCTTTTGAT ACACTTGAAA TGAGAGCTCT TTTTGCTAGT TCTGATTTCT GAGTGAAATT CATCTTCAAT
CAGAGAAGTG CTATGTGCAT ATTGCAAAGT TTATGCAGAA ATGTCGTGTT GGTTTCTACT ACTCTGTTCT CATCATGCCT
TTCTGATTGT GTGGTTTAAC ACGCTTCACA GATTCAAGCA GCTTTCAGAA CTGATGAAAT CCGCAGGACT CCTCCCACTC
CTCAGGATGA AATGCGCGCC GGGATGAGTT ATTTTCATGA AACTATATGG AAGGGTGTAC CAAAGTTCTT GCGCCGCATT
GATACTGCTC TGAAAAATAT TGGGATTAAT GAGCGTCTTC CTTACAATGC TCCTCTCATC CAGTTCTCAT CCTGGATGGG
TGGTGACCGT GATGGTATCT TCTCCTATCC TAACTTATAC ATCCATTTTT GTTTAGAAAG GAAAACAGAA CTTGGTTGAG
ATCTGTCACA TGCTCACATG TGCTATTGAC AGAAAATTGG CTTGTTTGTC CTCTTAGTGA CATCATGGTA TTAGTTCTAG
CAATTGGTTA TTTATTCCCC TTCCACACTT TTAAGTCAAC AAAGATTCCA TTTTTTTCAA ATAATTGTAT TATTCACTTG
TCTAAATATA TTTTTTGAGA TAACTGCAGC CTTTTCTGCT CCCTGTAATC CTGTCTGTTA GAAGAAGTTG AACTCTAAAA
CTGACTTGTT TTCTAGGAAA CCCAAGAGTT ACACCAGAGG TTACAAGAGA TGTATGCTTG TTGGCAAGAA TGATGGCTGC
TAACCTGTAC TTCTCTCAGA TAGAAGATCT GATGTTTGAG GTACAGCAGA ATTGCTTATT TTCATTGTTC TTAAAAAAGT
ACTGCAATAC TGATTTCTAA GTTTTAACAA TGCAATATGT TTTCCTAGCT CTCTATGTGG CGCTGCAGTG ATGAACTTCG
AATTCGTGCA GATGATTTGC ATTGCTCCTC CAGAAAAGCT GCAAAGCACT ATATAGGTAA CAATACCATA ACTGTGGTGA
TAATGAATTT TGGGTCGGCC TGCGCATTTG TTGATTTGTG TATCATTTTA TAGTCTGAAG GAAAAGCTGT ACTTTTGGTC
TGCTTGCCCT TCTCTTTTTA GCATATGAAG TAACCATTTT CAAGTTTTCA GATAGAGTTC TAATATGATG TTCATGCATT
TTTTTAATGA CCAATATATC ATTTTCTTAG CCTCTTTTTC TATCATAGCC ACCTCATATG CTTGTCTATA AGATCTGCCA
TCTTTCCTTT AATTTTTATC AGAGTTCACC TGTACTGTAA AATCTTCAGG TGATTTTACA CTTGAAAATT GTGCTTGCCA
ATTGCCAATT GTAATGTGTA TATTGTGGAT ACCAGTGTTG AATTATTAGT CAGGTTAATT TGAAAAATGC ATCTGCTAGT
TCAGAATCCA CTAGAACTTT AATATAAAGA AATTATTTGT TTAGCCAAAT ATAATTAGGC TGACATTGTT CTTCCAGAGG
CTGTGAAATC CCTACTCAAA ACATTTATCA AGTTGACTAC AGTGATGGAC TAAAATGGAC TGGACGTTTT TATGTCTAAT
ATGGATGCAT CAACTCCCGG CATAACTACA TTGATTAACT ACATTTCATT TTTCCTCGGT TTGTTACTCA TTTAGCTGAT
CAACCTGGGT GAAAGTCATG CATGATTTTA TAATTGACTG ATTTGTACTA TTTTTTAGCA AATGCCTACT AAATTTGCCT
CTTACTGAGA AAATGTTAAT GGTGCAGAAT TCTGGAAGCA AATTCCTCCA AATGAGCCTT ATCGTGTCAT ACTTGGTGGT
GTCAGGGATA AATTGTACTA TACGCGTGAA CGTACTCGCC ATCTATTGAC AACTGGAGTT TCTGAAATTC CAGAGGAGGC
AACGTTTACT AATGTTGAAG AGGTAATCCT ATTTATCTTA TATGTATCAT TGTGAATGTC ATTGTTGTAC TTATAGTACT
CAATTATCAC CCTCCTATCT TGCAGTTTCT GGAGCCGCTT GAGCTGTGCT ACAGATCATT ATGTGCTTGT GGTGACAAAC
CTATAGCTGA TGGAAGCCTT CTTGATTTCT TGCGTCAAGT ATCAACTTTT GGGCTGGCTC TTGTAAAACT TGACATAAGG
CAGGAGTCTG ATCGACACAC TGATGTCCTT GATGCCATAA CTACATATCT TGGGATTGGA TCTTACGCTG AATGGTCTGA
GGAGAAACGC CAGGATTGGC TTTTGTCCGA ACTAAGGGGC AAACGTCCTT TGTTTGGTCC TGATCTTCCT CAGACTGAAG
AAATTGCTGA TGTTTTAGGA ACATTTCACG TCCTTGCTGA GCTCCCGGCA GATTGTTTTG GTGCTTACAT CATCTCAATG
GCAACTGCAC CATCTGATGT GCTTGCTGTG GAGCTTCTAC AGCGGGAGTG CCATATAAAA CAGCCTCTGC GAGTTGTTCC
CCTATTTGAG AAACTTGCAG ATCTTGAAGC AGCTCCAGCA GCGGTGGCAC GACTATTTTC AATAGACTGG TACATGAATA
GGATTAATGG CAAGCAGGAG GTCATGATTG GATACTCAGA CTCTGGCAAG GATGCTGGTC GTCTTTCTGC AGCATGGCAA
ATGTACAAAG CACAAGAGGA GCTTGTCAAG GTGGCAAAGC ATTATGGTGT AAAGTTGACA ATGTTCCATG GAAGAGGTGG
AACAGTTGGC AGAGGAGGTG GTCCCAGTCA TCTTGCCATA TTATCTCAAC CACCAGACAC GATACATGGA TCACTTCGTG
TAACAGTACA GGGCGAGGTT ATTGAACACT CGTTTGGAGA GGAACACTTG TGCTTTAGAA CTCTGCAGCG CTTTACTGCA
GCTACTCTTG AGCATGGAAT GCATCCTCCA ATTTCCCCCA AACCAGAATG GCGTGCTCTA ATGGATGAGA TGGCTGTTGT
GGCAACAAAG GAATATCGAT CAATCGTCTT CAAGGAGCCA CGGTTTGTTG AATACTTCCG ATCGGTAAGT TCACCTCTAT
TCTGAATTCT TTCCCATAAA ATCTGCTGCA GTTCCGATAG GCGTAAATTT ATGCTTAATT TCAAGGCTTC TTGACAAGAC
CATTCTCTAA GCTAATTAGA TATACTCATG AGTTCTTTGC AGTTTGCATA GAGCGTGTGG TCTGATGCGA AGTTGCATGA
CAAATGTGTG TAGGCCATGA TAATTTTTCT AAGCTTCATG TCCACAGTTT TTTGCAATTT TACTTAACTA TGACAAGGGA
TCAAATACTA ATGTAGAGAT ATGCTCCTTC TCCATCAATA GGTGCACCTT CATGCTCCTT CTCCATCAAT AGGTGCACCT
TCACATTCTC TTGCCTGTGT TAATCGACTA AGAACTACCA TATAGAAGGG ATTGCATACA TATTTTGGTT CTCTGTTGTC
AGTCACTTCG TGCTTTATGT TATCTCTTAT CTGAGCTAGA TGTTGGTGGT GAACATGAAA TTCTGACATG TGTGTGTCCA
TCTGCTGTTC CAGGCAACAC CTGAGACAGA ATATGGCAGG ATGAACATTG GTAGCCGACC ATCAAAGAGA AAGCCTAGTG
GTGGCATTGA ATCGCTCCGT GCAATTCCTT GGATTTTTGC TTGGACACAA ACTAGGTTTC ATCTTCCTGT ATGGCTTGGA
TTTGGTGGAG CGTTCAAACA TATAATGCAG AAGGATATCA GGAACATCCA TACACTGAAA GAAATGTACA ATGAGTGGCC
ATTCTTCAGG GTCACCTTGG ACTTGCTTGA GATGGTTTTC GCCAAGGGAG ATCCAGGAAT TGCTGCTTTA TATGACAAAT
TGCTTGTGGC AGGTGATCTG CAATCCTTTG GAGAGCAGCT GAGAAACAAC TTTGAAGAGA CAAAACAGCT ACTCCTTCAG
GTAAACTACT CTAGAATAAG AATGGGCTAT ACTTAGATAT TAAGTTTGCT TGCATTTAAG CTGCACCTTT CTTTTTATCA
CCAGATATTG GCTTTAACCC ACACCAGTGG TTCTTTTAGA GTTTTTCCTT GAGATATATA TGATCCTGTT TGATGTGGAT
GATATGATCC TGAAGAAATC ATCAAAAGAT TTATGTTTGA AAATTATACT GAAGACAAAT CTGGAACTAC ACCTAGGCAT
TCTGAATCAT AAAAACAAAC TCCATGTTTT AAATAAGAGT GCACATCATA TCATCACTGA ATCTTTTCGC AGTCTAAGTT
GCGACAACTG AGATCTGAGA AGTTAGTGCC CTTGACACAT TGAAATCATC TGCAGGTTGC CGGTCACAAG GATATTCTGG
AAGGGGATCC TTACCTGAAG CAGCGTCTGC GGCTGCGTGA GTCGTACATC ACTACCTTGA ACGTTTGCCA AGCCTACACC
CTGAAGCGGA TAAGGGACCC TAGCTTCGAG GTGATGTCGC AGCCGGCCTT GTCGAAGGAG TTCGTCGACA GCAACCAGCC
TGCCGAGCTG GTCCAACTGA ACGCTGCGAG CGAGTACGCA CCTGGCCTGG AGGACACCCT CATCCTGACG ATGAAGGGCA
TTGCTGCCGG CATGCAGAAC ACAGGCTAGA TTGTCCACAA GAATGCTTCC AGCAGGTGCA ATCAATCAAT CATCAATAAC
TCCTTCCATG ATGAGATGGT GAATATGTTT AACTAGTACG TTCGCCGATG CTAGTGAATT CTGGAGACTT TTTTTTGCTC
GCACGTTTTC TTTTGGTTGT GTACTTGATG TAAATGTCAA GGGGGGACTT ATTTGGCTTT TGCAGCCCGA TCCAAAATAA
AATATGGACC AATCATTCT

Locus: Os02g0244700

Loading...

Locus: Os02g0244700

Loading...