Os02t0244700-04

Locus

Os02g0244700

Description

Similar to Phosphoenolpyruvate carboxylase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

PEPC-1, Osppc1, ppc1

Oryzabase Gene Name Synonym(s)

PEP carboxylase 1, Phosphoenolpyruvate carboxylase 1, PEPCase 1

Transcript Evidence

AK062201 (DDBJ, Best hit)

Protein Evidence

Q9FYX8 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: tricarboxylic acid cycle (GO:0006099)

Biological Process: carbon fixation (GO:0015977)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: phosphoenolpyruvate carboxylase activity (GO:0008964)

Functional domain (InterPro)

Pyruvate/Phosphoenolpyruvate kinase (IPR015813)

Phosphoenolpyruvate carboxylase, active site (IPR018129)

Phosphoenolpyruvate carboxylase (IPR021135)

Full-length cDNA

001-046-G07 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0244700-04)

RiceXPro (AK062201)

Others

Oryzabase (11419)

KEGG (Os02t0244700-04 (EC:4.1.1.31))

Transcript

1389 bp

>Os02t0244700-04 Similar to Phosphoenolpyruvate carboxylase.
GTACATGAATAGGATTAATGGCAAGCAGGAGGTCATGATTGGATACTCAGACTCTGGCAA
GGATGCTGGTCGTCTTTCTGCAGCATGGCAAATGTACAAAGCACAAGAGGAGCTTGTCAA
GGTGGCAAAGCATTATGGTGTAAAGTTGACAATGTTCCATGGAAGAGGTGGAACAGTTGG
CAGAGGAGGTGGTCCCAGTCATCTTGCCATATTATCTCAACCACCAGACACGATACATGG
ATCACTTCGTGTAACAGTACAGGGCGAGGTTATTGAACACTCGTTTGGAGAGGAACACTT
GTGCTTTAGAACTCTGCAGCGCTTTACTGCAGCTACTCTTGAGCATGGAATGCATCCTCC
AATTTCCCCCAAACCAGAATGGCGTGCTCTAATGGATGAGATGGCTGTTGTGGCAACAAA
GGAATATCGATCAATCGTCTTCAAGGAGCCACGGTTTGTTGAATACTTCCGATCGGCAAC
ACCTGAGACAGAATATGGCAGGATGAACATTGGTAGCCGACCATCAAAGAGAAAGCCTAG
TGGTGGCATTGAATCGCTCCGTGCAATTCCTTGGATTTTTGCTTGGACACAAACTAGGTT
TCATCTTCCTGTATGGCTTGGATTTGGTGGAGCGTTCAAACATATAATGCAGAAGGATAT
CAGGAACATCCATACACTGAAAGAAATGTACAATGAGTGGCCATTCTTCAGGGTCACCTT
GGACTTGCTTGAGATGGTTTTCGCCAAGGGAGATCCAGGAATTGCTGCTTTATATGACAA
ATTGCTTGTGGCAGGTGATCTGCAATCCTTTGGAGAGCAGCTGAGAAACAACTTTGAAGA
GACAAAACAGCTACTCCTTCAGGTTGCCGGTCACAAGGATATTCTGGAAGGGGATCCTTA
CCTGAAGCAGCGTCTGCGGCTGCGTGAGTCGTACATCACTACCTTGAACGTTTGCCAAGC
CTACACCCTGAAGCGGATAAGGGACCCTAGCTTCGAGGTGATGTCGCAGCCGGCCTTGTC
GAAGGAGTTCGTCGACAGCAACCAGCCTGCCGAGCTGGTCCAACTGAACGCTGCGAGCGA
GTACGCACCTGGCCTGGAGGACACCCTCATCCTGACGATGAAGGGCATTGCTGCCGGCAT
GCAGAACACAGGCTAGATTGTCCACAAGAATGCTTCCAGCAGGTGCAATCAATCAATCAT
CAATAACTCCTTCCATGATGAGATGGTGAATATGTTTAACTAGTACGTTCGCCGATGCTA
GTGAATTCTGGAGACTTTTTTTTGCTCGCACGTTTTCTTTTGGTTGTGTACTTGATGTAA
ATGTCAAGGGGGGACTTATTTGGCTTTTGCAGCCCGATCCAAAATAAAATATGGACCAAT
CATTCTACG

CDS

1155 bp

>Os02t0244700-04 Similar to Phosphoenolpyruvate carboxylase.
TACATGAATAGGATTAATGGCAAGCAGGAGGTCATGATTGGATACTCAGACTCTGGCAAG
GATGCTGGTCGTCTTTCTGCAGCATGGCAAATGTACAAAGCACAAGAGGAGCTTGTCAAG
GTGGCAAAGCATTATGGTGTAAAGTTGACAATGTTCCATGGAAGAGGTGGAACAGTTGGC
AGAGGAGGTGGTCCCAGTCATCTTGCCATATTATCTCAACCACCAGACACGATACATGGA
TCACTTCGTGTAACAGTACAGGGCGAGGTTATTGAACACTCGTTTGGAGAGGAACACTTG
TGCTTTAGAACTCTGCAGCGCTTTACTGCAGCTACTCTTGAGCATGGAATGCATCCTCCA
ATTTCCCCCAAACCAGAATGGCGTGCTCTAATGGATGAGATGGCTGTTGTGGCAACAAAG
GAATATCGATCAATCGTCTTCAAGGAGCCACGGTTTGTTGAATACTTCCGATCGGCAACA
CCTGAGACAGAATATGGCAGGATGAACATTGGTAGCCGACCATCAAAGAGAAAGCCTAGT
GGTGGCATTGAATCGCTCCGTGCAATTCCTTGGATTTTTGCTTGGACACAAACTAGGTTT
CATCTTCCTGTATGGCTTGGATTTGGTGGAGCGTTCAAACATATAATGCAGAAGGATATC
AGGAACATCCATACACTGAAAGAAATGTACAATGAGTGGCCATTCTTCAGGGTCACCTTG
GACTTGCTTGAGATGGTTTTCGCCAAGGGAGATCCAGGAATTGCTGCTTTATATGACAAA
TTGCTTGTGGCAGGTGATCTGCAATCCTTTGGAGAGCAGCTGAGAAACAACTTTGAAGAG
ACAAAACAGCTACTCCTTCAGGTTGCCGGTCACAAGGATATTCTGGAAGGGGATCCTTAC
CTGAAGCAGCGTCTGCGGCTGCGTGAGTCGTACATCACTACCTTGAACGTTTGCCAAGCC
TACACCCTGAAGCGGATAAGGGACCCTAGCTTCGAGGTGATGTCGCAGCCGGCCTTGTCG
AAGGAGTTCGTCGACAGCAACCAGCCTGCCGAGCTGGTCCAACTGAACGCTGCGAGCGAG
TACGCACCTGGCCTGGAGGACACCCTCATCCTGACGATGAAGGGCATTGCTGCCGGCATG
CAGAACACAGGCTAG

Protein

385 aa

>Os02t0244700-04 Similar to Phosphoenolpyruvate carboxylase.
YMNRINGKQEVMIGYSDSGKDAGRLSAAWQMYKAQEELVKVAKHYGVKLTMFHGRGGTVG
RGGGPSHLAILSQPPDTIHGSLRVTVQGEVIEHSFGEEHLCFRTLQRFTAATLEHGMHPP
ISPKPEWRALMDEMAVVATKEYRSIVFKEPRFVEYFRSATPETEYGRMNIGSRPSKRKPS
GGIESLRAIPWIFAWTQTRFHLPVWLGFGGAFKHIMQKDIRNIHTLKEMYNEWPFFRVTL
DLLEMVFAKGDPGIAALYDKLLVAGDLQSFGEQLRNNFEETKQLLLQVAGHKDILEGDPY
LKQRLRLRESYITTLNVCQAYTLKRIRDPSFEVMSQPALSKEFVDSNQPAELVQLNAASE
YAPGLEDTLILTMKGIAAGMQNTG*

5'UTR

chr02:8180092..8180092 (- strand) : 1 bp

CDS

chr02:8179618..8180091 (- strand) : 474 bp

chr02:8178722..8179108 (- strand) : 387 bp

chr02:8178053..8178346 (- strand) : 294 bp

3'UTR

chr02:8177820..8178052 (- strand) : 233 bp

FASTA

>Os02t0244700-04 class=Sequence position=chr02:8177820..8180092 (- strand)
GTACATGAAT AGGATTAATG GCAAGCAGGA GGTCATGATT GGATACTCAG ACTCTGGCAA GGATGCTGGT CGTCTTTCTG
CAGCATGGCA AATGTACAAA GCACAAGAGG AGCTTGTCAA GGTGGCAAAG CATTATGGTG TAAAGTTGAC AATGTTCCAT
GGAAGAGGTG GAACAGTTGG CAGAGGAGGT GGTCCCAGTC ATCTTGCCAT ATTATCTCAA CCACCAGACA CGATACATGG
ATCACTTCGT GTAACAGTAC AGGGCGAGGT TATTGAACAC TCGTTTGGAG AGGAACACTT GTGCTTTAGA ACTCTGCAGC
GCTTTACTGC AGCTACTCTT GAGCATGGAA TGCATCCTCC AATTTCCCCC AAACCAGAAT GGCGTGCTCT AATGGATGAG
ATGGCTGTTG TGGCAACAAA GGAATATCGA TCAATCGTCT TCAAGGAGCC ACGGTTTGTT GAATACTTCC GATCGGTAAG
TTCACCTCTA TTCTGAATTC TTTCCCATAA AATCTGCTGC AGTTCCGATA GGCGTAAATT TATGCTTAAT TTCAAGGCTT
CTTGACAAGA CCATTCTCTA AGCTAATTAG ATATACTCAT GAGTTCTTTG CAGTTTGCAT AGAGCGTGTG GTCTGATGCG
AAGTTGCATG ACAAATGTGT GTAGGCCATG ATAATTTTTC TAAGCTTCAT GTCCACAGTT TTTTGCAATT TTACTTAACT
ATGACAAGGG ATCAAATACT AATGTAGAGA TATGCTCCTT CTCCATCAAT AGGTGCACCT TCATGCTCCT TCTCCATCAA
TAGGTGCACC TTCACATTCT CTTGCCTGTG TTAATCGACT AAGAACTACC ATATAGAAGG GATTGCATAC ATATTTTGGT
TCTCTGTTGT CAGTCACTTC GTGCTTTATG TTATCTCTTA TCTGAGCTAG ATGTTGGTGG TGAACATGAA ATTCTGACAT
GTGTGTGTCC ATCTGCTGTT CCAGGCAACA CCTGAGACAG AATATGGCAG GATGAACATT GGTAGCCGAC CATCAAAGAG
AAAGCCTAGT GGTGGCATTG AATCGCTCCG TGCAATTCCT TGGATTTTTG CTTGGACACA AACTAGGTTT CATCTTCCTG
TATGGCTTGG ATTTGGTGGA GCGTTCAAAC ATATAATGCA GAAGGATATC AGGAACATCC ATACACTGAA AGAAATGTAC
AATGAGTGGC CATTCTTCAG GGTCACCTTG GACTTGCTTG AGATGGTTTT CGCCAAGGGA GATCCAGGAA TTGCTGCTTT
ATATGACAAA TTGCTTGTGG CAGGTGATCT GCAATCCTTT GGAGAGCAGC TGAGAAACAA CTTTGAAGAG ACAAAACAGC
TACTCCTTCA GGTAAACTAC TCTAGAATAA GAATGGGCTA TACTTAGATA TTAAGTTTGC TTGCATTTAA GCTGCACCTT
TCTTTTTATC ACCAGATATT GGCTTTAACC CACACCAGTG GTTCTTTTAG AGTTTTTCCT TGAGATATAT ATGATCCTGT
TTGATGTGGA TGATATGATC CTGAAGAAAT CATCAAAAGA TTTATGTTTG AAAATTATAC TGAAGACAAA TCTGGAACTA
CACCTAGGCA TTCTGAATCA TAAAAACAAA CTCCATGTTT TAAATAAGAG TGCACATCAT ATCATCACTG AATCTTTTCG
CAGTCTAAGT TGCGACAACT GAGATCTGAG AAGTTAGTGC CCTTGACACA TTGAAATCAT CTGCAGGTTG CCGGTCACAA
GGATATTCTG GAAGGGGATC CTTACCTGAA GCAGCGTCTG CGGCTGCGTG AGTCGTACAT CACTACCTTG AACGTTTGCC
AAGCCTACAC CCTGAAGCGG ATAAGGGACC CTAGCTTCGA GGTGATGTCG CAGCCGGCCT TGTCGAAGGA GTTCGTCGAC
AGCAACCAGC CTGCCGAGCT GGTCCAACTG AACGCTGCGA GCGAGTACGC ACCTGGCCTG GAGGACACCC TCATCCTGAC
GATGAAGGGC ATTGCTGCCG GCATGCAGAA CACAGGCTAG ATTGTCCACA AGAATGCTTC CAGCAGGTGC AATCAATCAA
TCATCAATAA CTCCTTCCAT GATGAGATGG TGAATATGTT TAACTAGTAC GTTCGCCGAT GCTAGTGAAT TCTGGAGACT
TTTTTTTGCT CGCACGTTTT CTTTTGGTTG TGTACTTGAT GTAAATGTCA AGGGGGGACT TATTTGGCTT TTGCAGCCCG
ATCCAAAATA AAATATGGAC CAATCATTCT ACG

Locus: Os02g0244700

Loading...

Locus: Os02g0244700

Loading...