Os02t0249000-01

Locus

Os02g0249000

Description

Glutelin, Seed strage protein

RAP-DB Gene Symbol Synonym(s)

GLUD1, GluD1, GluD-1, OsEnS-33

RAP-DB Gene Name Synonym(s)

GLUTELIN D, Glutelin type-D, endosperm-specific gene 33

CGSNL Gene Symbol

GLUD1

CGSNL Gene Name

GLUTELIN D

Oryzabase Gene Symbol Synonym(s)

GluD1, GluD-1, OsEnS-33, EnS-33, GluD

Oryzabase Gene Name Synonym(s)

Glutelin type-D, endosperm-specific gene 33

Transcript Evidence

AY429650 (Genbank)

AK243018 (Genbank)

Protein Evidence

Q6K508 (UniProt)

Literature

PMID: 18980953

Note

  • Exon-intron structures and exon sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

October 22, 2009

Gene Ontology (GO)

Molecular Function: nutrient reservoir activity (GO:0045735)

Functional domain (InterPro)

11-S seed storage protein, plant (IPR006044)

Cupin 1 (IPR006045)

Cupin, RmlC-type (IPR011051)

RmlC-like jelly roll fold (IPR014710)

11-S seed storage protein, conserved site (IPR022379)

Full-length cDNA

J090098O20 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0249000-01)

Others

Oryzabase (10215)

Transcript

1613 bp

>Os02t0249000-01 Glutelin, Seed strage protein
TCGATCAAATTTTAACTTCTCCAAATAGCTATGGCAActactacctctctattgtcttcc
tgtctctgtgctcttctcttggctccgctctttagccaaggTGTAGATGCATGGGAAAGC
CGACAAGGGGCTTCCAGGCAGTGCAGATTTGATAGGTTACAAGCATTTGAGCCCCTAAGA
AAGGTACGATCGGAAGCTGGGGACACAGAGTACTTTGATGAGAGAAATGAGCAGTTTCGA
TGCGCTGGTGTCTTTGTCATTCGGCGCGTGATTGAGCCACAAGGCCTTGTGGTGCCTCGA
TACTCGAACACTCCTGCTCTAGCCTACATAATCCAAGGAAAAGGTTACGTAGGATTGACT
TTTCCTGGTTGCCCAGCAACACACCAACAACAATTCCAACTATTTGAACAAAGACAGAGC
GACCAAGCTCATAAGTTTAGAGATGAGCACCAGAAGATTCACGAATTTAGGCAAGGGGAT
GTTGTTGCACTTCCGGCTAGTGTTGCACATTGGTTCTACAATGGTGGTGATACACCGGCT
GTTGTTGTCTATGTTTATGACATAAAAAGTTTTGCTAATCAGCTTGAACCAAGGCAGAAG
GAGTTTTTATTAGCTGGTAACAACCAGAGAGGGCAACAAATATTTGAACATTCCATCTTT
CAACACTCTGGACAAAATATATTTAGTGGGTTCAATACTGAGGTACTTAGCGAGGCCCTT
GGAATAAACACGGAGGCTTCCAAGAGGCTCCAAAGTCAAAATGACCAAAGGGGAGATATC
ATTCGAGTGAAGCACGGGCTTCAATTGTTGAAACCCACATTAACACAACGACAGGAAGAA
CATCGTCAATATCAACAAGTCCAGTATCGTGAAGGACAATATAATGGATTGGACGAGAAT
TTCTGTACAATAAAGGCAAGGGTAAACATTGAAAATCCTAGCCGCGCTGACTACTACAAC
CCTCGTGCTGGAAGGATAACCCTTCTTAACAACCAAAAGTTCCCTATTCTCAACCTTATT
GGAATGGGTGCTGCAAGAGTAAACTTATACCAGAATGCTCTTCTCTCACCCTTCTGGAAC
ATTAATGCCCATAGTGTAGTGTATATCATCCAAGGAAGTGTGCGAGTACAGGTTGCCAAT
AATCAAGGAAGATCTGTGTTTAATGGTGTACTTCATCAGGGGCAACTATTAATCATACCA
CAAAACCATGCCGTCATTAAGAAAGCCGAGCACAATGGGTGCCAGTATGTCGCAATAAAG
ACAATTTCGGACCCTACGGTGAGTTGGGTTGCTGGAAAGAACTCCATATTACGTGCATTG
CCTGTAGATGTTATTGCCAATGCTTATCGTATCTCGAGGGATGAAGCCCGACGTCTAAAG
AATAATAGGGCAGATGAGATTGGCCCTTTTACTCCTCGTTTCCCCCAGAAGAGCCAGCGG
GGTTACCAGTTCCTAACTGAAGGCCTCTCTTTAATCGGCATGTAAAACTTATAGATTATG
AGTACTATGCAAGCAAAAATAATAAAGCACATCAAGCTTGTTGTGGATGCTTTGCAATAG
TTTTATGTACTTTGTTTTGCAAAGAACAAAATTAAAACAAAACTGAGTTCATG

CDS

1455 bp

>Os02t0249000-01 Glutelin, Seed strage protein
ATGGCAActactacctctctattgtcttcctgtctctgtgctcttctcttggctccgctc
tttagccaaggTGTAGATGCATGGGAAAGCCGACAAGGGGCTTCCAGGCAGTGCAGATTT
GATAGGTTACAAGCATTTGAGCCCCTAAGAAAGGTACGATCGGAAGCTGGGGACACAGAG
TACTTTGATGAGAGAAATGAGCAGTTTCGATGCGCTGGTGTCTTTGTCATTCGGCGCGTG
ATTGAGCCACAAGGCCTTGTGGTGCCTCGATACTCGAACACTCCTGCTCTAGCCTACATA
ATCCAAGGAAAAGGTTACGTAGGATTGACTTTTCCTGGTTGCCCAGCAACACACCAACAA
CAATTCCAACTATTTGAACAAAGACAGAGCGACCAAGCTCATAAGTTTAGAGATGAGCAC
CAGAAGATTCACGAATTTAGGCAAGGGGATGTTGTTGCACTTCCGGCTAGTGTTGCACAT
TGGTTCTACAATGGTGGTGATACACCGGCTGTTGTTGTCTATGTTTATGACATAAAAAGT
TTTGCTAATCAGCTTGAACCAAGGCAGAAGGAGTTTTTATTAGCTGGTAACAACCAGAGA
GGGCAACAAATATTTGAACATTCCATCTTTCAACACTCTGGACAAAATATATTTAGTGGG
TTCAATACTGAGGTACTTAGCGAGGCCCTTGGAATAAACACGGAGGCTTCCAAGAGGCTC
CAAAGTCAAAATGACCAAAGGGGAGATATCATTCGAGTGAAGCACGGGCTTCAATTGTTG
AAACCCACATTAACACAACGACAGGAAGAACATCGTCAATATCAACAAGTCCAGTATCGT
GAAGGACAATATAATGGATTGGACGAGAATTTCTGTACAATAAAGGCAAGGGTAAACATT
GAAAATCCTAGCCGCGCTGACTACTACAACCCTCGTGCTGGAAGGATAACCCTTCTTAAC
AACCAAAAGTTCCCTATTCTCAACCTTATTGGAATGGGTGCTGCAAGAGTAAACTTATAC
CAGAATGCTCTTCTCTCACCCTTCTGGAACATTAATGCCCATAGTGTAGTGTATATCATC
CAAGGAAGTGTGCGAGTACAGGTTGCCAATAATCAAGGAAGATCTGTGTTTAATGGTGTA
CTTCATCAGGGGCAACTATTAATCATACCACAAAACCATGCCGTCATTAAGAAAGCCGAG
CACAATGGGTGCCAGTATGTCGCAATAAAGACAATTTCGGACCCTACGGTGAGTTGGGTT
GCTGGAAAGAACTCCATATTACGTGCATTGCCTGTAGATGTTATTGCCAATGCTTATCGT
ATCTCGAGGGATGAAGCCCGACGTCTAAAGAATAATAGGGCAGATGAGATTGGCCCTTTT
ACTCCTCGTTTCCCCCAGAAGAGCCAGCGGGGTTACCAGTTCCTAACTGAAGGCCTCTCT
TTAATCGGCATGTAA

Protein

485 aa

>Os02t0249000-01 Glutelin, Seed strage protein
MATTTSLLSSCLCALLLAPLFSQGVDAWESRQGASRQCRFDRLQAFEPLRKVRSEAGDTE
YFDERNEQFRCAGVFVIRRVIEPQGLVVPRYSNTPALAYIIQGKGYVGLTFPGCPATHQQ
QFQLFEQRQSDQAHKFRDEHQKIHEFRQGDVVALPASVAHWFYNGGDTPAVVVYVYDIKS
FANQLEPRQKEFLLAGNNQRGQQIFEHSIFQHSGQNIFSGFNTEVLSEALGINTEASKRL
QSQNDQRGDIIRVKHGLQLLKPTLTQRQEEHRQYQQVQYREGQYNGLDENFCTIKARVNI
ENPSRADYYNPRAGRITLLNNQKFPILNLIGMGAARVNLYQNALLSPFWNINAHSVVYII
QGSVRVQVANNQGRSVFNGVLHQGQLLIIPQNHAVIKKAEHNGCQYVAIKTISDPTVSWV
AGKNSILRALPVDVIANAYRISRDEARRLKNNRADEIGPFTPRFPQKSQRGYQFLTEGLS
LIGM*

5'UTR

chr02:8408653..8408682 (- strand) : 30 bp

CDS

chr02:8408346..8408652 (- strand) : 307 bp

chr02:8407974..8408236 (- strand) : 263 bp

chr02:8407389..8407841 (- strand) : 453 bp

chr02:8406837..8407268 (- strand) : 432 bp

3'UTR

chr02:8406709..8406836 (- strand) : 128 bp

FASTA

>Os02t0249000-01 class=Sequence position=chr02:8406709..8408682 (- strand)
TCGATCAAAT TTTAACTTCT CCAAATAGCT ATGGCAActa ctacctctct attgtcttcc tgtctctgtg ctcttctctt
ggctccgctc tttagccaag gTGTAGATGC ATGGGAAAGC CGACAAGGGG CTTCCAGGCA GTGCAGATTT GATAGGTTAC
AAGCATTTGA GCCCCTAAGA AAGGTACGAT CGGAAGCTGG GGACACAGAG TACTTTGATG AGAGAAATGA GCAGTTTCGA
TGCGCTGGTG TCTTTGTCAT TCGGCGCGTG ATTGAGCCAC AAGGCCTTGT GGTGCCTCGA TACTCGAACA CTCCTGCTCT
AGCCTACATA ATCCAAGGTT TGTGAGGGCA CAAAGATATT CACATGGATA TCACAATTTT ATAGCAGTCA AATATGAAAC
ACATGTTTGC CTTTTTATAA TAGTAATGTA CATGTGCTTA TTGCAGGAAA AGGTTACGTA GGATTGACTT TTCCTGGTTG
CCCAGCAACA CACCAACAAC AATTCCAACT ATTTGAACAA AGACAGAGCG ACCAAGCTCA TAAGTTTAGA GATGAGCACC
AGAAGATTCA CGAATTTAGG CAAGGGGATG TTGTTGCACT TCCGGCTAGT GTTGCACATT GGTTCTACAA TGGTGGTGAT
ACACCGGCTG TTGTTGTCTA TGTTTATGAC ATAAAAAGTT TTGCTAATCA GCTTGAACCA AGGCAGAAGG TATCAATTTT
ATATTCATTA TCCTCCCCAA TCGGCTTTGT TCATTTTTGA ATACTCTGAA TTGTGCTTTT TCTTTAGATT TACTTCATTC
ATTAGCAAGC CATTCCATTT ATTTTTTACT CAAATGTTTA GGAGTTTTTA TTAGCTGGTA ACAACCAGAG AGGGCAACAA
ATATTTGAAC ATTCCATCTT TCAACACTCT GGACAAAATA TATTTAGTGG GTTCAATACT GAGGTACTTA GCGAGGCCCT
TGGAATAAAC ACGGAGGCTT CCAAGAGGCT CCAAAGTCAA AATGACCAAA GGGGAGATAT CATTCGAGTG AAGCACGGGC
TTCAATTGTT GAAACCCACA TTAACACAAC GACAGGAAGA ACATCGTCAA TATCAACAAG TCCAGTATCG TGAAGGACAA
TATAATGGAT TGGACGAGAA TTTCTGTACA ATAAAGGCAA GGGTAAACAT TGAAAATCCT AGCCGCGCTG ACTACTACAA
CCCTCGTGCT GGAAGGATAA CCCTTCTTAA CAACCAAAAG TTCCCTATTC TCAACCTTAT TGGAATGGGT GCTGCAAGAG
TAAACTTATA CCAGGTAATA TGGGTAATGA TGATTACAAT GCTATTATAA CAATCATTTT TTTTGGTGCA AAATCTATAA
TATGTAACGT TGTTGAGATA ATGGCATAAC CCGACCTTTT CCCACTTACT GCAGAATGCT CTTCTCTCAC CCTTCTGGAA
CATTAATGCC CATAGTGTAG TGTATATCAT CCAAGGAAGT GTGCGAGTAC AGGTTGCCAA TAATCAAGGA AGATCTGTGT
TTAATGGTGT ACTTCATCAG GGGCAACTAT TAATCATACC ACAAAACCAT GCCGTCATTA AGAAAGCCGA GCACAATGGG
TGCCAGTATG TCGCAATAAA GACAATTTCG GACCCTACGG TGAGTTGGGT TGCTGGAAAG AACTCCATAT TACGTGCATT
GCCTGTAGAT GTTATTGCCA ATGCTTATCG TATCTCGAGG GATGAAGCCC GACGTCTAAA GAATAATAGG GCAGATGAGA
TTGGCCCTTT TACTCCTCGT TTCCCCCAGA AGAGCCAGCG GGGTTACCAG TTCCTAACTG AAGGCCTCTC TTTAATCGGC
ATGTAAAACT TATAGATTAT GAGTACTATG CAAGCAAAAA TAATAAAGCA CATCAAGCTT GTTGTGGATG CTTTGCAATA
GTTTTATGTA CTTTGTTTTG CAAAGAACAA AATTAAAACA AAACTGAGTT CATG

Locus: Os02g0249000

Loading...

Locus: Os02g0249000

Loading...