Os02t0250300-01

Locus

Os02g0250300

Description

Bromodomain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

GTE4, OsGTE4

Oryzabase Gene Name Synonym(s)

GENERAL TRANSCRIPTION FACTOR GROUP E4

Transcript Evidence

AK318547 (DDBJ, Best hit)

Protein Evidence

A3A538 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

Bromodomain (IPR001487)

Full-length cDNA

J075125B17 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0250300-01)

Others

Oryzabase (12400)

KEGG (Os02t0250300-01)

Transcript

2627 bp

>Os02t0250300-01 Bromodomain containing protein.
GCGCACACGACCCCCCCGACCCGACGCCGCCACCACCCACCCCCGTCGCAGCAGCTCACC
CCCACCTCCACCGCCATAGCCATAGCCAAGCCGCGGGAGCTCCAATCCGAGTCGACCCCG
GCGGATTCCGGCAGGGCTAGGCGCGAATCCCTCGCCGCGGCGGCCGCCTGCATCGATCCG
GGGCCTCGCGGGAGGGGGGGGACCGGATTTAGGGTTTAATTTATGCATGGCCTCGTCCCC
TCCTGGCGCCGGCGCCGGCGGGGAGGAGCGGCCCGCGGCGAGCCCCGCGGCCCCGGCCGT
GGCGGAGGCGGTGGAGGAGGGGCCGGTGACGTCGCGGTGGGCGCCGGAGATCAGGGTGTA
CCGGCGCAAGTACCCACGCAAAAACCCTAAACCCcctccgaaccctagccctagctccag
ccccctcgcgcaaaccctagcctcgattcggaggtcgattcgccgccccgaggatgggcc
tgcggcgcctcggcctgatccgcccgccgcgcccgcttcctccccccatccccctccgcc
GAGCGCCCCGGTTGCCCCCGCGCAGCAGGGGGAGCCCGCCGCGCCCGCTTCCGACGACGT
CTCCGCGGGGCCTAATCGGGACGGCGGGGCCGTTCCCAACGGCCATGGAGACGTCCGGGC
GGCCGCCGAGGAGAAGGCGCGGAAGCGGAGGGCGCGGAGCGAGCTGCGGCGGCAGCTTGC
GTCGGAGCTCGACCAGGTGCGTGGGCTTTCCAAGCGGCTGAAGGCGGCCGCTGAGGCCAT
CGCGGCTGAGTCTGCAGCGGCCCTTGCTTTGCCTGTGGTGGTGCCGCCGCCTCAGCTTCC
TGTTGGGTATGCGCACTCGCAGTTCGCACTCGCTGATCCTGTGACGCCCATACCTGGTCA
AGTTGCTGGTGCTATTGTTCCGGTCCGCTCAGTGATGCAGCGCGGGCCACTAACCGTGTC
AGTGACTCACACAGAGTCCTTCGAGAAGGAGAAGCGGACACCAAAGGCGAATCAGTTGTA
TCAAAATTCAGAGTTCTTGCTTGCCAAGGATAAGTTTCCGCCTTCAGATTCACATGGTCG
TAAGAAACCCAAGCACCACAAGAAGAAGCATCGTTCCTTAGCATCTCATGGTGCTGGTTA
TGATGCTGAGCAGAGGCTATACTCTCATGCTTTTAAGAAATCTATGTCGCTGCTTTCTAG
GCTAATGAAGCacaaatttggttgggtgtttaacaagcctgtagatgctgttgcgcttgg
tttgcatgattattttgctattatcaagcacccaatggatcttggcacgataaagacccg
actcacgcatggccagtacaggaacccgagggagtttgctgatgatgtacggctgacgtt
ccataatgccatgacctataatcccaaggggcaggatgtgcatTTCATGGCTGAGCAGTT
GTTGGGAATCTTTGAGGCGCAGTGGCCCGAAATTGAGGCTGAGGTTCAGTACCTTGCCTC
ATGTCCGCCATTGCCAAATAAGTTTCCACCTCCACCAATTGACGTGCGCTTCCTTGATCG
GTCAGATTCTGTAAAACACCATATGGTGTTGGACTCCAAGTCAAGGCCATTAAGTCATAC
TCCCACTTATAGTGCCAGGACTCCATCGATGAAGAAACCAAAGGCCAAGGATCCGGATAA
GAGAGATATGACAATAGATGAGAAGCGGAAGCTTAGTAACAACCTTCAGAATTTGCCACC
GGAGAAGCTTGATGTTGTTGTGCAGATCATTAAGAACAAGAATCTGTCTGTTAGACAGCA
TGATGATGAGATTGAGGTTGAAATAGATAGCATGGATACTGAGACACTTTGGGAACTTGA
TAGATTTGTGGCCAACTACAAGAAGAACCTGAGCAAGCAAAAGAGGAAGGCTGAGCGAGC
CATGCTTGCAAGGCAGGATGCAGAGTTGCATGCACAACATGTTGCCCCACAACAACCAAG
TCAAGAGCCTAATATTGGTGTAAAATCTCCAAAGCAAAATTTGATTGTGGATGAGAAATT
AGCTACTTCTGTGCCAGAACAAGCTGATAATAATGGACAAAATGCAAGTAGATCGAGCAG
CTCTAGCAGCTCCAGCAGTGATACAGGATCCTCTTCTAGTGACTCAGACAGTGATAGCTC
CTCTTCAGATGGATCAGATGCCGCCAATTCATCTTGAAATATTCAGAACTTCATCCAATG
AAGAATAACTGTCTAATTGTATTTGGCATGACAATGCCTCAGCAAGACTCAAGACATGCC
TATCTTCGTCTATCTAGGAAATCTCCGAGTTGCAGCTAGGATGTCATCCGAAGGCAGGAT
TCTGCAAAGGCCTGCTGAGCCTGATACAAGTTCCATTCTGCTGCTTCTGTGTACTTATGA
TTGTAGGTTAACTTTGTACACTAGTCCATTTTCATTTGTTTGGCAGCAGAGTGCAGCTGT
ATTATATGCACCTTGGCATTATGGATACCCCCAGCTGAAGGCAAGGTATTCACTAGGCTC
AGATCCAATAAGACAGGCATGCATGCTGACGCTGATCTTATCTGGGTAGGAGTTCTGTAG
CCTGTAGATTAGCCACAGCTGGAGCATTATTTACGTTTTGCCGCGTT

CDS

1971 bp

>Os02t0250300-01 Bromodomain containing protein.
ATGGCCTCGTCCCCTCCTGGCGCCGGCGCCGGCGGGGAGGAGCGGCCCGCGGCGAGCCCC
GCGGCCCCGGCCGTGGCGGAGGCGGTGGAGGAGGGGCCGGTGACGTCGCGGTGGGCGCCG
GAGATCAGGGTGTACCGGCGCAAGTACCCACGCAAAAACCCTAAACCCcctccgaaccct
agccctagctccagccccctcgcgcaaaccctagcctcgattcggaggtcgattcgccgc
cccgaggatgggcctgcggcgcctcggcctgatccgcccgccgcgcccgcttcctccccc
catccccctccgccGAGCGCCCCGGTTGCCCCCGCGCAGCAGGGGGAGCCCGCCGCGCCC
GCTTCCGACGACGTCTCCGCGGGGCCTAATCGGGACGGCGGGGCCGTTCCCAACGGCCAT
GGAGACGTCCGGGCGGCCGCCGAGGAGAAGGCGCGGAAGCGGAGGGCGCGGAGCGAGCTG
CGGCGGCAGCTTGCGTCGGAGCTCGACCAGGTGCGTGGGCTTTCCAAGCGGCTGAAGGCG
GCCGCTGAGGCCATCGCGGCTGAGTCTGCAGCGGCCCTTGCTTTGCCTGTGGTGGTGCCG
CCGCCTCAGCTTCCTGTTGGGTATGCGCACTCGCAGTTCGCACTCGCTGATCCTGTGACG
CCCATACCTGGTCAAGTTGCTGGTGCTATTGTTCCGGTCCGCTCAGTGATGCAGCGCGGG
CCACTAACCGTGTCAGTGACTCACACAGAGTCCTTCGAGAAGGAGAAGCGGACACCAAAG
GCGAATCAGTTGTATCAAAATTCAGAGTTCTTGCTTGCCAAGGATAAGTTTCCGCCTTCA
GATTCACATGGTCGTAAGAAACCCAAGCACCACAAGAAGAAGCATCGTTCCTTAGCATCT
CATGGTGCTGGTTATGATGCTGAGCAGAGGCTATACTCTCATGCTTTTAAGAAATCTATG
TCGCTGCTTTCTAGGCTAATGAAGCacaaatttggttgggtgtttaacaagcctgtagat
gctgttgcgcttggtttgcatgattattttgctattatcaagcacccaatggatcttggc
acgataaagacccgactcacgcatggccagtacaggaacccgagggagtttgctgatgat
gtacggctgacgttccataatgccatgacctataatcccaaggggcaggatgtgcatTTC
ATGGCTGAGCAGTTGTTGGGAATCTTTGAGGCGCAGTGGCCCGAAATTGAGGCTGAGGTT
CAGTACCTTGCCTCATGTCCGCCATTGCCAAATAAGTTTCCACCTCCACCAATTGACGTG
CGCTTCCTTGATCGGTCAGATTCTGTAAAACACCATATGGTGTTGGACTCCAAGTCAAGG
CCATTAAGTCATACTCCCACTTATAGTGCCAGGACTCCATCGATGAAGAAACCAAAGGCC
AAGGATCCGGATAAGAGAGATATGACAATAGATGAGAAGCGGAAGCTTAGTAACAACCTT
CAGAATTTGCCACCGGAGAAGCTTGATGTTGTTGTGCAGATCATTAAGAACAAGAATCTG
TCTGTTAGACAGCATGATGATGAGATTGAGGTTGAAATAGATAGCATGGATACTGAGACA
CTTTGGGAACTTGATAGATTTGTGGCCAACTACAAGAAGAACCTGAGCAAGCAAAAGAGG
AAGGCTGAGCGAGCCATGCTTGCAAGGCAGGATGCAGAGTTGCATGCACAACATGTTGCC
CCACAACAACCAAGTCAAGAGCCTAATATTGGTGTAAAATCTCCAAAGCAAAATTTGATT
GTGGATGAGAAATTAGCTACTTCTGTGCCAGAACAAGCTGATAATAATGGACAAAATGCA
AGTAGATCGAGCAGCTCTAGCAGCTCCAGCAGTGATACAGGATCCTCTTCTAGTGACTCA
GACAGTGATAGCTCCTCTTCAGATGGATCAGATGCCGCCAATTCATCTTGA

Protein

657 aa

>Os02t0250300-01 Bromodomain containing protein.
MASSPPGAGAGGEERPAASPAAPAVAEAVEEGPVTSRWAPEIRVYRRKYPRKNPKPPPNP
SPSSSPLAQTLASIRRSIRRPEDGPAAPRPDPPAAPASSPHPPPPSAPVAPAQQGEPAAP
ASDDVSAGPNRDGGAVPNGHGDVRAAAEEKARKRRARSELRRQLASELDQVRGLSKRLKA
AAEAIAAESAAALALPVVVPPPQLPVGYAHSQFALADPVTPIPGQVAGAIVPVRSVMQRG
PLTVSVTHTESFEKEKRTPKANQLYQNSEFLLAKDKFPPSDSHGRKKPKHHKKKHRSLAS
HGAGYDAEQRLYSHAFKKSMSLLSRLMKHKFGWVFNKPVDAVALGLHDYFAIIKHPMDLG
TIKTRLTHGQYRNPREFADDVRLTFHNAMTYNPKGQDVHFMAEQLLGIFEAQWPEIEAEV
QYLASCPPLPNKFPPPPIDVRFLDRSDSVKHHMVLDSKSRPLSHTPTYSARTPSMKKPKA
KDPDKRDMTIDEKRKLSNNLQNLPPEKLDVVVQIIKNKNLSVRQHDDEIEVEIDSMDTET
LWELDRFVANYKKNLSKQKRKAERAMLARQDAELHAQHVAPQQPSQEPNIGVKSPKQNLI
VDEKLATSVPEQADNNGQNASRSSSSSSSSSDTGSSSSDSDSDSSSSDGSDAANSS*

5'UTR

chr02:8490392..8490617 (+ strand) : 226 bp

CDS

chr02:8490618..8492369 (+ strand) : 1752 bp

chr02:8492472..8492511 (+ strand) : 40 bp

chr02:8492620..8492742 (+ strand) : 123 bp

chr02:8492860..8492915 (+ strand) : 56 bp

3'UTR

chr02:8492916..8492918 (+ strand) : 3 bp

chr02:8497577..8498003 (+ strand) : 427 bp

FASTA

>Os02t0250300-01 class=Sequence position=chr02:8490392..8498003 (+ strand)
GCGCACACGA CCCCCCCGAC CCGACGCCGC CACCACCCAC CCCCGTCGCA GCAGCTCACC CCCACCTCCA CCGCCATAGC
CATAGCCAAG CCGCGGGAGC TCCAATCCGA GTCGACCCCG GCGGATTCCG GCAGGGCTAG GCGCGAATCC CTCGCCGCGG
CGGCCGCCTG CATCGATCCG GGGCCTCGCG GGAGGGGGGG GACCGGATTT AGGGTTTAAT TTATGCATGG CCTCGTCCCC
TCCTGGCGCC GGCGCCGGCG GGGAGGAGCG GCCCGCGGCG AGCCCCGCGG CCCCGGCCGT GGCGGAGGCG GTGGAGGAGG
GGCCGGTGAC GTCGCGGTGG GCGCCGGAGA TCAGGGTGTA CCGGCGCAAG TACCCACGCA AAAACCCTAA ACCCcctccg
aaccctagcc ctagctccag ccccctcgcg caaaccctag cctcgattcg gaggtcgatt cgccgccccg aggatgggcc
tgcggcgcct cggcctgatc cgcccgccgc gcccgcttcc tccccccatc cccctccgcc GAGCGCCCCG GTTGCCCCCG
CGCAGCAGGG GGAGCCCGCC GCGCCCGCTT CCGACGACGT CTCCGCGGGG CCTAATCGGG ACGGCGGGGC CGTTCCCAAC
GGCCATGGAG ACGTCCGGGC GGCCGCCGAG GAGAAGGCGC GGAAGCGGAG GGCGCGGAGC GAGCTGCGGC GGCAGCTTGC
GTCGGAGCTC GACCAGGTGC GTGGGCTTTC CAAGCGGCTG AAGGCGGCCG CTGAGGCCAT CGCGGCTGAG TCTGCAGCGG
CCCTTGCTTT GCCTGTGGTG GTGCCGCCGC CTCAGCTTCC TGTTGGGTAT GCGCACTCGC AGTTCGCACT CGCTGATCCT
GTGACGCCCA TACCTGGTCA AGTTGCTGGT GCTATTGTTC CGGTCCGCTC AGTGATGCAG CGCGGGCCAC TAACCGTGTC
AGTGACTCAC ACAGAGTCCT TCGAGAAGGA GAAGCGGACA CCAAAGGCGA ATCAGTTGTA TCAAAATTCA GAGTTCTTGC
TTGCCAAGGA TAAGTTTCCG CCTTCAGATT CACATGGTCG TAAGAAACCC AAGCACCACA AGAAGAAGCA TCGTTCCTTA
GCATCTCATG GTGCTGGTTA TGATGCTGAG CAGAGGCTAT ACTCTCATGC TTTTAAGAAA TCTATGTCGC TGCTTTCTAG
GCTAATGAAG Cacaaatttg gttgggtgtt taacaagcct gtagatgctg ttgcgcttgg tttgcatgat tattttgcta
ttatcaagca cccaatggat cttggcacga taaagacccg actcacgcat ggccagtaca ggaacccgag ggagtttgct
gatgatgtac ggctgacgtt ccataatgcc atgacctata atcccaaggg gcaggatgtg catTTCATGG CTGAGCAGTT
GTTGGGAATC TTTGAGGCGC AGTGGCCCGA AATTGAGGCT GAGGTTCAGT ACCTTGCCTC ATGTCCGCCA TTGCCAAATA
AGTTTCCACC TCCACCAATT GACGTGCGCT TCCTTGATCG GTCAGATTCT GTAAAACACC ATATGGTGTT GGACTCCAAG
TCAAGGCCAT TAAGTCATAC TCCCACTTAT AGTGCCAGGA CTCCATCGAT GAAGAAACCA AAGGCCAAGG ATCCGGATAA
GAGAGATATG ACAATAGATG AGAAGCGGAA GCTTAGTAAC AACCTTCAGA ATTTGCCACC GGAGAAGCTT GATGTTGTTG
TGCAGATCAT TAAGAACAAG AATCTGTCTG TTAGACAGCA TGATGATGAG ATTGAGGTTG AAATAGATAG CATGGATACT
GAGACACTTT GGGAACTTGA TAGATTTGTG GCCAACTACA AGAAGAACCT GAGCAAGCAA AAGAGGAAGG CTGAGCGAGC
CATGCTTGCA AGGCAGGATG CAGAGTTGCA TGCACAACAT GTTGCCCCAC AACAACCAGT ATGGGCATTC AATCATTCCT
ATTCCTATTC TATAAGTAGC ACTATATAGT TAATTGAATT TTATGATTGG TGCTGAAAGT TACAGTTTCT TGGATTGCAG
AGTCAAGAGC CTAATATTGG TGTAAAATCT CCAAAGCAAA GTAAGTTAGA TCTGCTCTAT TTTGTACTTC ATCTAATTGT
CCAAGTCAAT TGCCAGGAAC TATGGATTAT GGAAGCAATA TAATTTACTT ATTTTCTTAT ATGAGCAGAT TTGATTGTGG
ATGAGAAATT AGCTACTTCT GTGCCAGAAC AAGCTGATAA TAATGGACAA AATGCAAGTA GATCGAGCAG CTCTAGCAGC
TCCAGCAGTG ATACAGGATC CTCTTCTAGT GGTAATATTT CTTTCTGCCC TTGGTTTTGC TCATCATATT TTGGTATTTA
CAGTATATAT ATCTACCAGC TGTAGACATT TGAGTTAGTG TGTAATCAAT TAATATTCTT TTTGGCAGAC TCAGACAGTG
ATAGCTCCTC TTCAGATGGA TCAGATGCCG CCAATTCATC TTGAAATGTA GGTAGGTTTT ATTAAGTAGT TTTTGTGTTC
TTATTGCTGT ATTTGTTTCA CTATAATCTA ACCTAGTGAG TTAATTTAAG GTTTTTCTGT TATTATTGAG TTCCTACTTT
TAATTTATGT CTCAATGATC CTATTGATGG CAGTCTGTTT CTCCAATATT GCTGGTGGTT ATTCAAATAA ATCCATTCTT
GTGCAAACAT AGACATTTTT ATTTCTGTGA AATCAATATA GTTAAGTACT ATTTATACTA TACTCCGTGT GAAATCGTAT
GTATTCACAT CTCTGTATGT TTTAGGAGAA ATTTAGAATG TTCCTATCTG ACATGCTAAT GTGAATATAT TGATTCGTAA
GCATGCGTAC CAGGAGTATA CCATGGTAAA GCTCAACTCA TAAAATATGT TAATCTGAAC TAGTTAATTA CCCACTCTTA
ATTGATTATA TAGTCAGGCT GACTGATTTT AAGACTTACC ACCCTCTAGC GTAGAACTGG GACTCTGGGA GGGCATCTAC
TTGGCATGTA CATCTAGCTG TAAGCCAAAC TGGATGATTT TATGAAAGCA CAGTTCAACT GAATGGATGT AAAAAATCTT
ACGAGATGCA TACAATGGGG AAGTCTTTGT GTTTCCTTTC TCTGTAAACT CAGATGGTCG AGGATTCATC TGATAATTTG
TAACTCATAA GATGGGAGTG AAATTGTGGT TAACAAGCTG ACATGTTATG TATAGCCCAA GATTTGGAAT TTGGGAAGGT
GGAGAAATAG AATTTGTAGT TTCTTAGGAA GGGATTAGTT CCAGTTTGTT ATGCTTCCAT ATGTTAACAC TTAGTTTTCC
TAATCCTAAA AGATAATTTC TATTTATTGG GTTCCTCAAA AGTTTCTATC CATTAATTGT TCAGATGGCT GTATAGGAAG
GCATCCTTAT ATTAATGAGC AATGGTAACA GAAAGATGCA CTGAGAAAAG AAGTTTCATA TTTTCCTCTT GTTCTTCTAG
ATTGCTTTAG AGCCTTGTGT CTACAGCAAG AGTACGCCTC CCAGTAGACA AATCAAGGGT CAGAGTCAGT GCCCTATCCT
GGTTTATCGG GTCCTTATCC TGTTTCACAT TACAAGAGGT ACTTGTGGGT TTCTCTCCTA GGTTCAGGGG GTCAATTATA
TTTCAGGCAA CGCTACAAAC TTGATGGTTT TAGTGTGTCA AGCTAAGCAG AAAAACAAGA GATTATCATG TTTGTGGACT
AGATGCAGGG CCCCTTGTGT TTACTGACGT CCAAACAGGG TTAGGGTATT CTATCTGTGT TATGGTTTCT GGAGCCATAG
CATTAAAAGC CAGACTGGTC ATCAGGTCAG ACTCTCGGTT TGTTGTTCTG ACAGTCTGAC CGGAGGAACA CTGGTTAAGC
TGTGGTTAAA AGAAACTTCA AATATActcc ctgcttccca aaatataagg tgtgttagcc ttttacagag tctccaggag
tatactttga atctttttta ccattaattt attttgtaat acattatcga caactaagaa attaatatca tatgaaagta
cattctaata cgaatctaat gatatcacat gcgtggcaat aaaaatatac tttaattatt agtaaaaaaa cacatttgac
tgttctaaca ataagggtgc tttgtatttt gggatggaaa gagTATTTAA TATTCCTTCA TGGACACAAC AAAGATACCA
CCTGTCCAGT CTGTCAGTTC ATATTATGCC TAGAGGCAGG TGGATATGAG TCTGCTCACA TTTCTCTTTA ATATCACAGC
GCTATATTAT GGTAAGCATT CCCCCATTTG GAATGCACTT TGCATCGCTT AACAATGTTT GTGACATCTG TCATCACATC
CAACTAGTAT TCACTAAGGC CCTAGGTGTG TCTGTTGGAG GACTGGCGCC TGGTAATCAG CCGTATAGAT TGGATAAATC
GGCTAGGTGA GTAAGGCTTG AAGTTGAAGG TGTCAGCACT GCAAGCTACC TCGGCATGAG GAGGCTAGGC GTCTGCCTTT
CAGAATGCTG CCTCCAAGGC TTCAACTATC ATTAGTTAGT ACAAGAGAGT ATGTTTGTCC AGTTTGGCCT GAGTCAGAAG
GCGTTGGGGT CATTGGAGTC GATGACGGTT AACTCATAGC TAGAAAGGTT CAAAATATCT CCACTGATCC AAATCTTGTC
TAGCTCTAGC TCGATTGTTG CTCTTCGTGA GTATTTTCAA TAATAACTTC ATCTCAAATT GGTATTTGAT AATACGACCA
ATTCACGCAA GCACATCCCC ATGAGTGTTT TAGTGCATAC TTCTAATTCA CTTCATGTGC AATTATGTGC ATGAGCCTGT
GCTCTCTGCG CAAACAGTTC CCGACAACCC TTTCTACCAT ACATGAAAAT CTTGTTTTGT TTGACACTAA ACATTCTCAT
GAGGATGAAT TGCTTCATTG TACTCCTACA GTGTAGTAGC TGAATGCCAT AGCCATCTTG AACACTTGTG CGACACATTC
TCAAAAACCT TGTGGATGGT GGCTACATTG TTAAACCTAG GATAGGATGG GGAGGGTCAC AGTTACAGAA ATGCAGTTTG
TCTCAGCAAA GCCACGATAT TTTGGTGTCC TAGATCAAAT GCCATGATTC AAATTGGAGA TGCCATTTGT TCCCCAAAGA
CTCATTCATT CCTTTTCAAA TTCTTTCTTA TGGATCATTG GATCCTACCC ATTGCAAAAC ACAACAAAAC ATGACACTTA
TCATACATGG CTACATGAGA AACTATTTTA ACCTCATTTA TGAATACATA TTATGTAATG ATTGAAATGT TTGTCTTAGC
CATTCAAATC TTCTTTTGTC ACAAAGCTTT TAATTCTTAG TTCCTGCTAA CTGGAAACAC ATTTTCTTTG CACTGGGCAT
AGTACGAAAA GTTAGTCTGA TGGCCAGTTC CGGTTTAACT GCAGTTCACG GAATTTGAAT TATAGTGTAT GTTCCATTTC
AAATGCAAGT TGATGGTGGT GGGGTGGTAG TGGTGACGTT TTCAGTTTGA AGACCCATGC TTGAACCCCT TCATCCTTTT
TTCGCTTGAT AGTTGATACA AGTTGTGTGC CTGGATGTTC TGTTAGGCCT TGCTTTGGCC CCATTCTCTG CTATAGCCAT
GCTTTTCAGG TCCACCAGCA TTTTCTGGAA TGTTGCCTGG TTCAGAGTGA AGCTGCCTGG TCTATCCAGT TCAAAGTGTT
CCATATGCAT GAGTGGTCTT AGCAGATCAG ACTGAGCACA ACACCAATTC CAGTTAAAAC TGCTTGTCTG GTCCAGCTTT
TTTCAACTAT GGCACTGGGA TTGAGCAATA CCTGTTTCTT CCTTCTTTTT TAAGATTTAA GATAGTAACT CGGGGATTTA
TTCTCTCTCC ATCATGTGGA GTGCTATGTA TAAGCCATTT TCACTTGGTT GAATTTGCCT AATAGAAGAA TTTTTGCCAG
TTGGAAGAAT GGAGGTATGG CAGTAAAAAC AATTAAACAG ATGTGTGTAA CATCCCTACT ACATCCAGAC ATTTATAATA
TGGTTACATA ACAATTGGAG AAAGGTCTAT CTCCTTTAAG TAAAGAACTA CTAAGAAATG ATGCCTGCAC TGAAATTCAT
ATTTACAGAG CAATAATTTA TCTTTAGAAT ATCCCTTAAG TGCTTCAGTT TGTTGTGGTA ATCAATTATT TACTCACTGC
TATAATGTGT TTAACTTCTT GTCTGTTTCC TTCTGGAGTT CCTTTCTTCA TCCTGTAGTC ATTCTACTTG GTTTTGCCTT
GCTGTGCTTC TTGATAAAAT AATAAGTACG TTGAGGACCT TCCTGTGCTT TAGTTTGCTT GTGCTTTTAT TCTTACTAGT
AAATTGTGGT GTTATGCTAG GATGGCCATC TGAAGACCTT TTCAGAGTTA AACCTTGGTG CTTGCAACCT ATTTATGCAT
CAGTATTCTT TTATGAAGAA ATCCTGCAAA TGATATAGAC CCAAGTCTTT GGTTGATTGG CAGTAGTCTT CCTTCATACA
GTTACACTTG GTCTCAATGA GAAAAAGAAT CAAAAACAAA TTTAAAACCC TGTAGTCTCA TAGTTGTCTC TCTTGCATAG
GGACTTAGTA TAATCGAGTT TCTTTCCTGA TATGATCACA TGAGCTAGCA GCCCGATTAA TTGGTGCCAA ACACTTAGGT
TACTTTTCTC AGTCACCATT TTCAGAGCTT TAGGAGTTGA CAGTGTCATT TCGAATATCT GATTCATCAT TTTTTGTGAT
ATGTACTTTC ATATGCTTAT AAATGTGCAT TTTGGAAGTA TGGAACTGTG AGAGTCAGAT GATTGTTGCT TTTAGCATAG
ACTCTGTATA GTACTTTGGG TGTGTGAAAG TAATAATTTA GCCTTTTATA GGCGGAATTG GAGTCGCTTG TCAGAGCGTG
ACAATCTTGG CTGCATAGAT TTATTGTACA TGCGAGGGTG TGCAGTTGAT CACTGCATCT GTTGATCCTG CTTTTTACCT
GCTATAGCAA CCCTAGTGGT TTCATTAAAA CATATTTGGA CCTATTAGCT CTGTTCCATG ACTGTCTAGG TACTTTAGTT
CTATAAGTGG CTCTGCTATT CTCTAATTGG TTCACTCATA ACGTTCACCT TCTCCTGAAT TGCAGATTCA GAACTTCATC
CAATGAAGAA TAACTGTCTA ATTGTATTTG GCATGACAAT GCCTCAGCAA GACTCAAGAC ATGCCTATCT TCGTCTATCT
AGGAAATCTC CGAGTTGCAG CTAGGATGTC ATCCGAAGGC AGGATTCTGC AAAGGCCTGC TGAGCCTGAT ACAAGTTCCA
TTCTGCTGCT TCTGTGTACT TATGATTGTA GGTTAACTTT GTACACTAGT CCATTTTCAT TTGTTTGGCA GCAGAGTGCA
GCTGTATTAT ATGCACCTTG GCATTATGGA TACCCCCAGC TGAAGGCAAG GTATTCACTA GGCTCAGATC CAATAAGACA
GGCATGCATG CTGACGCTGA TCTTATCTGG GTAGGAGTTC TGTAGCCTGT AGATTAGCCA CAGCTGGAGC ATTATTTACG
TTTTGCCGCG TT

Locus: Os02g0250300

Loading...

Locus: Os02g0250300

Loading...