Os02t0252200-01

Locus

Os02g0252200

Description

Similar to GRAB2 protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

NAC13

CGSNL Gene Name

NAC DOMAIN-CONTAINING PROTEIN 13

Oryzabase Gene Symbol Synonym(s)

ONAC013, ONAC13, ONAC064, ONA064, DLN53, OsDLN53

Oryzabase Gene Name Synonym(s)

NAC domain-containing protein 013, NAC domain-containing protein 13, NAC domain-containing protein 64, DLN repressor 53, DLN motif protein 53

Transcript Evidence

AK063943 (DDBJ, Best hit)

Protein Evidence

B4FNX8 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Functional domain (InterPro)

No apical meristem (NAM) protein (IPR003441)

Full-length cDNA

001-123-E07 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0252200-01)

RiceXPro (AK063943)

Others

Oryzabase (11463)

KEGG (Os02t0252200-01)

Transcript

1561 bp

>Os02t0252200-01 Similar to GRAB2 protein.
ATCTCAAATCAGATCATCTCAAGTTCCCAAACCCTAGCTATCTCTGCTGGTCTCCCCCAA
GCTCTCCTTTATATAACACAAACTACATCATCTCCTTTCTCTTGTGTGCAACATCACAAA
CACAACCTTTCACTCCCATCTTGGCTTTCTTTCCTGTCTCTAGCTTAGCTACCTGTTGCT
TCCAAGCTGAGAAAAACCAAGCAAAAGAAGCTGTTTGTGTGCCTTTCCAAGAGTGAAAAA
AAAAATGCATCCTAATGGCGCGCCGCTGGCCGtgccaccgggtttccggttccatccgac
ggacgaggaattgctctactactacctgaggaagaaggttgcttatgaggccatagatct
cgacgtcatcagggagattgacctcaacaagcttgagccttgggatctcaaagatcgatg
caggattgggacgggggcgcaggaggagtggtacttcttcagccacaaggacaagaagta
cccgacggggacgaggaccaaccgcgccacggtggccggcttctggaaggccaccggccg
tgacaaggccatcttcctcggcagcggcggcggcacgaggattggcctgaggaagacgct
ggtgttctacaccggaagggccccgcacggcaagaagaccgactggatcatgcacgagta
ccgcctCGACGACGACAATGTCGACGTCCCGGAGGAAGGATGGGTGGTGTGTAGGGTATT
CAAGAAGAAGAGCATCCATCAGAGGGGCTTCGACCAGCCGGACATGGCGGCGGCGGCCGA
CGAGGACGAGCTCCGGTACCAGCTGCTCCACGGCGCGGGCATGTCGTCGTCGCCGGTCGA
CCAGAAGCACGTGCTCCTCCAAGAGCAGCTCGTCGCGCACGGCGCCCATGGCGGCGGCTT
CGTCGTCCCGGCGTTCGAAGCCTCCATGCACCTCCCGCAGCTCGCCAGCGCCGACGCGGC
GCCGTGCGGCGGCGGCGGCGGCGGCCATGTCGCGTTCGCCTCCATGAACCCGCTCGACGC
CGCCGGCTGCGGCTCGCAGAACATGATGACGATGAAGATGGCAGCGACATCCGGTGGCGA
GATGCTGCTGATGAGCGGCGGCGGCGTCGACGGCGGCCGCTTCGGCGCCGCCGCCGACTG
GTCGATCCTTGACAAGCTCCTGGCGTCGCACCAGAACCTCGACCAGCTCTTCCATGGCAA
GGTCGCCGGAGCGCATCAGCAGCAGCAGCAGATGGCCATGGACGCCGCCTCGTCGTTGCA
GAGGTTGCCGTTCCACCATTACCTCGGGTTGGAAGCTGCAGATCTTCTCAAGTTTTCTAT
GTAGAAATTTTTTAGCTATATGTAATGTAGTATCTGCTTCTTGATTAATTAAGCAGGCGA
ATTCTTGTTTTTTTTTCTCTTCTAGTTTTGTCAAATTATTAGTACTAGTTTCAGTTTGAT
AAGGTTAATATCGGAGTTCTGCTAGCTACTGGCCTACTGTTCTATAAGCATGTGTATACA
GACAGTCTGAATGCCGTATGAACTTCTTTCTAAATGTTTCAATTCAAGTTTGTTCATCTC
G

CDS

1080 bp

>Os02t0252200-01 Similar to GRAB2 protein.
ATGCATCCTAATGGCGCGCCGCTGGCCGtgccaccgggtttccggttccatccgacggac
gaggaattgctctactactacctgaggaagaaggttgcttatgaggccatagatctcgac
gtcatcagggagattgacctcaacaagcttgagccttgggatctcaaagatcgatgcagg
attgggacgggggcgcaggaggagtggtacttcttcagccacaaggacaagaagtacccg
acggggacgaggaccaaccgcgccacggtggccggcttctggaaggccaccggccgtgac
aaggccatcttcctcggcagcggcggcggcacgaggattggcctgaggaagacgctggtg
ttctacaccggaagggccccgcacggcaagaagaccgactggatcatgcacgagtaccgc
ctCGACGACGACAATGTCGACGTCCCGGAGGAAGGATGGGTGGTGTGTAGGGTATTCAAG
AAGAAGAGCATCCATCAGAGGGGCTTCGACCAGCCGGACATGGCGGCGGCGGCCGACGAG
GACGAGCTCCGGTACCAGCTGCTCCACGGCGCGGGCATGTCGTCGTCGCCGGTCGACCAG
AAGCACGTGCTCCTCCAAGAGCAGCTCGTCGCGCACGGCGCCCATGGCGGCGGCTTCGTC
GTCCCGGCGTTCGAAGCCTCCATGCACCTCCCGCAGCTCGCCAGCGCCGACGCGGCGCCG
TGCGGCGGCGGCGGCGGCGGCCATGTCGCGTTCGCCTCCATGAACCCGCTCGACGCCGCC
GGCTGCGGCTCGCAGAACATGATGACGATGAAGATGGCAGCGACATCCGGTGGCGAGATG
CTGCTGATGAGCGGCGGCGGCGTCGACGGCGGCCGCTTCGGCGCCGCCGCCGACTGGTCG
ATCCTTGACAAGCTCCTGGCGTCGCACCAGAACCTCGACCAGCTCTTCCATGGCAAGGTC
GCCGGAGCGCATCAGCAGCAGCAGCAGATGGCCATGGACGCCGCCTCGTCGTTGCAGAGG
TTGCCGTTCCACCATTACCTCGGGTTGGAAGCTGCAGATCTTCTCAAGTTTTCTATGTAG

Protein

360 aa

>Os02t0252200-01 Similar to GRAB2 protein.
MHPNGAPLAVPPGFRFHPTDEELLYYYLRKKVAYEAIDLDVIREIDLNKLEPWDLKDRCR
IGTGAQEEWYFFSHKDKKYPTGTRTNRATVAGFWKATGRDKAIFLGSGGGTRIGLRKTLV
FYTGRAPHGKKTDWIMHEYRLDDDNVDVPEEGWVVCRVFKKKSIHQRGFDQPDMAAAADE
DELRYQLLHGAGMSSSPVDQKHVLLQEQLVAHGAHGGGFVVPAFEASMHLPQLASADAAP
CGGGGGGHVAFASMNPLDAAGCGSQNMMTMKMAATSGGEMLLMSGGGVDGGRFGAAADWS
ILDKLLASHQNLDQLFHGKVAGAHQQQQQMAMDAASSLQRLPFHHYLGLEAADLLKFSM*

5'UTR

chr02:8582543..8582773 (+ strand) : 231 bp

chr02:8582921..8582933 (+ strand) : 13 bp

CDS

chr02:8582934..8583102 (+ strand) : 169 bp

chr02:8583276..8583553 (+ strand) : 278 bp

chr02:8583663..8584295 (+ strand) : 633 bp

3'UTR

chr02:8584296..8584532 (+ strand) : 237 bp

FASTA

>Os02t0252200-01 class=Sequence position=chr02:8582543..8584532 (+ strand)
ATCTCAAATC AGATCATCTC AAGTTCCCAA ACCCTAGCTA TCTCTGCTGG TCTCCCCCAA GCTCTCCTTT ATATAACACA
AACTACATCA TCTCCTTTCT CTTGTGTGCA ACATCACAAA CACAACCTTT CACTCCCATC TTGGCTTTCT TTCCTGTCTC
TAGCTTAGCT ACCTGTTGCT TCCAAGCTGA GAAAAACCAA GCAAAAGAAG CTGTTTGTGT GCCTTTCCAA GGTATAGATT
TGCATGCATA TACACTTTAT CCTGTCCAGT TAGAAACTTA TATAAGGACT TGTAAGTTTC TTTACTGAAT TAAGGTTAAG
TAAACTTGCT AAATGCATGA GTTTTCTGAT GCATTGTGAA TTTGTGGGTA TTTCTCAGAG TGAAAAAAAA AATGCATCCT
AATGGCGCGC CGCTGGCCGt gccaccgggt ttccggttcc atccgacgga cgaggaattg ctctactact acctgaggaa
gaaggttgct tatgaggcca tagatctcga cgtcatcagg gagattgacc tcaacaagct tgagccttgg gatctcaaag
gtataaacac atatgcttgc taattaatta actagcactt ctttagaaaa tgaacaaact tacaaatgta tatgttgtgt
tggtgcttaa tttttttcac aaaatcacct aacgatttta aatttaactt tatgaatata ttgattaaca tatatatggt
tgcattgatg cagatcgatg caggattggg acgggggcgc aggaggagtg gtacttcttc agccacaagg acaagaagta
cccgacgggg acgaggacca accgcgccac ggtggccggc ttctggaagg ccaccggccg tgacaaggcc atcttcctcg
gcagcggcgg cggcacgagg attggcctga ggaagacgct ggtgttctac accggaaggg ccccgcacgg caagaagacc
gactggatca tgcacgagta ccgcctCGAC GACGACAATG TCGACGTCCC GGTAAGCACC ATCACCATTC TAATCGATTT
CAAGCTAGAT AGTTTAGATC AAGTAGAGTT GAGCTCTGAT TAATGGCGGT TTCTTGGAAT GTTGCATTGG ATGCGTGCAG
GAGGAAGGAT GGGTGGTGTG TAGGGTATTC AAGAAGAAGA GCATCCATCA GAGGGGCTTC GACCAGCCGG ACATGGCGGC
GGCGGCCGAC GAGGACGAGC TCCGGTACCA GCTGCTCCAC GGCGCGGGCA TGTCGTCGTC GCCGGTCGAC CAGAAGCACG
TGCTCCTCCA AGAGCAGCTC GTCGCGCACG GCGCCCATGG CGGCGGCTTC GTCGTCCCGG CGTTCGAAGC CTCCATGCAC
CTCCCGCAGC TCGCCAGCGC CGACGCGGCG CCGTGCGGCG GCGGCGGCGG CGGCCATGTC GCGTTCGCCT CCATGAACCC
GCTCGACGCC GCCGGCTGCG GCTCGCAGAA CATGATGACG ATGAAGATGG CAGCGACATC CGGTGGCGAG ATGCTGCTGA
TGAGCGGCGG CGGCGTCGAC GGCGGCCGCT TCGGCGCCGC CGCCGACTGG TCGATCCTTG ACAAGCTCCT GGCGTCGCAC
CAGAACCTCG ACCAGCTCTT CCATGGCAAG GTCGCCGGAG CGCATCAGCA GCAGCAGCAG ATGGCCATGG ACGCCGCCTC
GTCGTTGCAG AGGTTGCCGT TCCACCATTA CCTCGGGTTG GAAGCTGCAG ATCTTCTCAA GTTTTCTATG TAGAAATTTT
TTAGCTATAT GTAATGTAGT ATCTGCTTCT TGATTAATTA AGCAGGCGAA TTCTTGTTTT TTTTTCTCTT CTAGTTTTGT
CAAATTATTA GTACTAGTTT CAGTTTGATA AGGTTAATAT CGGAGTTCTG CTAGCTACTG GCCTACTGTT CTATAAGCAT
GTGTATACAG ACAGTCTGAA TGCCGTATGA ACTTCTTTCT AAATGTTTCA ATTCAAGTTT GTTCATCTCG 

Locus: Os02g0252200

Loading...

Locus: Os02g0252200

Loading...