Os02t0252200-02

Locus

Os02g0252200

Description

Similar to GRAB2 protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

NAC13

CGSNL Gene Name

NAC DOMAIN-CONTAINING PROTEIN 13

Oryzabase Gene Symbol Synonym(s)

ONAC013, ONAC13, ONAC064, ONA064, DLN53, OsDLN53

Oryzabase Gene Name Synonym(s)

NAC domain-containing protein 013, NAC domain-containing protein 13, NAC domain-containing protein 64, DLN repressor 53, DLN motif protein 53

Transcript Evidence

AK101280 (DDBJ, Best hit)

Protein Evidence

B4FNX8 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Functional domain (InterPro)

No apical meristem (NAM) protein (IPR003441)

Full-length cDNA

J033033C18 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0252200-02)

RiceXPro (AK101280)

Others

Oryzabase (11463)

KEGG (Os02t0252200-02)

Transcript

1457 bp

>Os02t0252200-02 Similar to GRAB2 protein.
TGTGCAACATCACAAACACAACCTTTCACTCCCATCTTGGCTTTCTTTCCTGTCTCTAGC
TTAGCTACCTGTTGCTTCCAAGCTGAGAAAAACCAAGCAAAAGAAGCTGTTTGTGTGCCT
TTCCAAGAGTGAAAAAAAAAATGCATCCTAATGGCGCGCCGCTGGCCGtgccaccgggtt
tccggttccatccgacggacgaggaattgctctactactacctgaggaagaaggttgctt
atgaggccatagatctcgacgtcatcagggagattgacctcaacaagcttgagccttggg
atctcaaagatcgatgcaggattgggacgggggcgcaggaggagtggtacttcttcagcc
acaaggacaagaagtacccgacggggacgaggaccaaccgcgccacggtggccggcttct
ggaaggccaccggccgtgacaaggccatcttcctcggcagcggcggcggcacgaggattg
gcctgaggaagacgctggtgttctacaccggaagggccccgcacggcaagaagaccgact
ggatcatgcacgagtaccgcctCGACGACGACAATGTCGACGTCCCGGAGGAAGGATGGG
TGGTGTGTAGGGTATTCAAGAAGAAGAGCATCCATCAGAGGGGCTTCGACCAGCCGGACA
TGGCGGCGGCGGCCGACGAGGACGAGCTCCGGTACCAGCTGCTCCACGGCGCGGGCATGT
CGTCGTCGCCGGTCGACCAGAAGCACGTGCTCCTCCAAGAGCAGCTCGTCGCGCACGGCG
CCCATGGCGGCGGCTTCGTCGTCCCGGCGTTCGAAGCCTCCATGCACCTCCCGCAGCTCG
CCAGCGCCGACGCGGCGCCGTGCGGCGGCGGCGGCGGCGGCCATGTCGCGTTCGCCTCCA
TGAACCCGCTCGACGCCGCCGGCTGCGGCTCGCAGAACATGATGACGATGAAGATGGCAG
CGACATCCGGTGGCGAGATGCTGCTGATGAGCGGCGGCGGCGTCGACGGCGGCCGCTTCG
GCGCCGCCGCCGACTGGTCGATCCTTGACAAGCTCCTGGCGTCGCACCAGAACCTCGACC
AGCTCTTCCATGGCAAGGTCGCCGGAGCGCATCAGCAGCAGCAGCAGATGGCCATGGACG
CCGCCTCGTCGTTGCAGAGGTTGCCGTTCCACCATTACCTCGGGTTGGAAGCTGCAGATC
TTCTCAAGTTTTCTATGTAGAAATTTTTTAGCTATATGTAATGTAGTATCTGCTTCTTGA
TTAATTAAGCAGGCGAATTCTTGTTTTTTTTTCTCTTCTAGTTTTGTCAAATTATTAGTA
CTAGTTTCAGTTTGATAAGGTTAATATCGGAGTTCTGCTAGCTACTGGCCTACTGTTCTA
TAAGCATGTGTATACAGACAGTCTGAATGCCGTATGAACTTCTTTCTAAATGTTTCAATT
CAAGTTTGTTCATCTCG

CDS

1080 bp

>Os02t0252200-02 Similar to GRAB2 protein.
ATGCATCCTAATGGCGCGCCGCTGGCCGtgccaccgggtttccggttccatccgacggac
gaggaattgctctactactacctgaggaagaaggttgcttatgaggccatagatctcgac
gtcatcagggagattgacctcaacaagcttgagccttgggatctcaaagatcgatgcagg
attgggacgggggcgcaggaggagtggtacttcttcagccacaaggacaagaagtacccg
acggggacgaggaccaaccgcgccacggtggccggcttctggaaggccaccggccgtgac
aaggccatcttcctcggcagcggcggcggcacgaggattggcctgaggaagacgctggtg
ttctacaccggaagggccccgcacggcaagaagaccgactggatcatgcacgagtaccgc
ctCGACGACGACAATGTCGACGTCCCGGAGGAAGGATGGGTGGTGTGTAGGGTATTCAAG
AAGAAGAGCATCCATCAGAGGGGCTTCGACCAGCCGGACATGGCGGCGGCGGCCGACGAG
GACGAGCTCCGGTACCAGCTGCTCCACGGCGCGGGCATGTCGTCGTCGCCGGTCGACCAG
AAGCACGTGCTCCTCCAAGAGCAGCTCGTCGCGCACGGCGCCCATGGCGGCGGCTTCGTC
GTCCCGGCGTTCGAAGCCTCCATGCACCTCCCGCAGCTCGCCAGCGCCGACGCGGCGCCG
TGCGGCGGCGGCGGCGGCGGCCATGTCGCGTTCGCCTCCATGAACCCGCTCGACGCCGCC
GGCTGCGGCTCGCAGAACATGATGACGATGAAGATGGCAGCGACATCCGGTGGCGAGATG
CTGCTGATGAGCGGCGGCGGCGTCGACGGCGGCCGCTTCGGCGCCGCCGCCGACTGGTCG
ATCCTTGACAAGCTCCTGGCGTCGCACCAGAACCTCGACCAGCTCTTCCATGGCAAGGTC
GCCGGAGCGCATCAGCAGCAGCAGCAGATGGCCATGGACGCCGCCTCGTCGTTGCAGAGG
TTGCCGTTCCACCATTACCTCGGGTTGGAAGCTGCAGATCTTCTCAAGTTTTCTATGTAG

Protein

360 aa

>Os02t0252200-02 Similar to GRAB2 protein.
MHPNGAPLAVPPGFRFHPTDEELLYYYLRKKVAYEAIDLDVIREIDLNKLEPWDLKDRCR
IGTGAQEEWYFFSHKDKKYPTGTRTNRATVAGFWKATGRDKAIFLGSGGGTRIGLRKTLV
FYTGRAPHGKKTDWIMHEYRLDDDNVDVPEEGWVVCRVFKKKSIHQRGFDQPDMAAAADE
DELRYQLLHGAGMSSSPVDQKHVLLQEQLVAHGAHGGGFVVPAFEASMHLPQLASADAAP
CGGGGGGHVAFASMNPLDAAGCGSQNMMTMKMAATSGGEMLLMSGGGVDGGRFGAAADWS
ILDKLLASHQNLDQLFHGKVAGAHQQQQQMAMDAASSLQRLPFHHYLGLEAADLLKFSM*

5'UTR

chr02:8582647..8582773 (+ strand) : 127 bp

chr02:8582921..8582933 (+ strand) : 13 bp

CDS

chr02:8582934..8583102 (+ strand) : 169 bp

chr02:8583276..8583553 (+ strand) : 278 bp

chr02:8583663..8584295 (+ strand) : 633 bp

3'UTR

chr02:8584296..8584532 (+ strand) : 237 bp

FASTA

>Os02t0252200-02 class=Sequence position=chr02:8582647..8584532 (+ strand)
TGTGCAACAT CACAAACACA ACCTTTCACT CCCATCTTGG CTTTCTTTCC TGTCTCTAGC TTAGCTACCT GTTGCTTCCA
AGCTGAGAAA AACCAAGCAA AAGAAGCTGT TTGTGTGCCT TTCCAAGGTA TAGATTTGCA TGCATATACA CTTTATCCTG
TCCAGTTAGA AACTTATATA AGGACTTGTA AGTTTCTTTA CTGAATTAAG GTTAAGTAAA CTTGCTAAAT GCATGAGTTT
TCTGATGCAT TGTGAATTTG TGGGTATTTC TCAGAGTGAA AAAAAAAATG CATCCTAATG GCGCGCCGCT GGCCGtgcca
ccgggtttcc ggttccatcc gacggacgag gaattgctct actactacct gaggaagaag gttgcttatg aggccataga
tctcgacgtc atcagggaga ttgacctcaa caagcttgag ccttgggatc tcaaaggtat aaacacatat gcttgctaat
taattaacta gcacttcttt agaaaatgaa caaacttaca aatgtatatg ttgtgttggt gcttaatttt tttcacaaaa
tcacctaacg attttaaatt taactttatg aatatattga ttaacatata tatggttgca ttgatgcaga tcgatgcagg
attgggacgg gggcgcagga ggagtggtac ttcttcagcc acaaggacaa gaagtacccg acggggacga ggaccaaccg
cgccacggtg gccggcttct ggaaggccac cggccgtgac aaggccatct tcctcggcag cggcggcggc acgaggattg
gcctgaggaa gacgctggtg ttctacaccg gaagggcccc gcacggcaag aagaccgact ggatcatgca cgagtaccgc
ctCGACGACG ACAATGTCGA CGTCCCGGTA AGCACCATCA CCATTCTAAT CGATTTCAAG CTAGATAGTT TAGATCAAGT
AGAGTTGAGC TCTGATTAAT GGCGGTTTCT TGGAATGTTG CATTGGATGC GTGCAGGAGG AAGGATGGGT GGTGTGTAGG
GTATTCAAGA AGAAGAGCAT CCATCAGAGG GGCTTCGACC AGCCGGACAT GGCGGCGGCG GCCGACGAGG ACGAGCTCCG
GTACCAGCTG CTCCACGGCG CGGGCATGTC GTCGTCGCCG GTCGACCAGA AGCACGTGCT CCTCCAAGAG CAGCTCGTCG
CGCACGGCGC CCATGGCGGC GGCTTCGTCG TCCCGGCGTT CGAAGCCTCC ATGCACCTCC CGCAGCTCGC CAGCGCCGAC
GCGGCGCCGT GCGGCGGCGG CGGCGGCGGC CATGTCGCGT TCGCCTCCAT GAACCCGCTC GACGCCGCCG GCTGCGGCTC
GCAGAACATG ATGACGATGA AGATGGCAGC GACATCCGGT GGCGAGATGC TGCTGATGAG CGGCGGCGGC GTCGACGGCG
GCCGCTTCGG CGCCGCCGCC GACTGGTCGA TCCTTGACAA GCTCCTGGCG TCGCACCAGA ACCTCGACCA GCTCTTCCAT
GGCAAGGTCG CCGGAGCGCA TCAGCAGCAG CAGCAGATGG CCATGGACGC CGCCTCGTCG TTGCAGAGGT TGCCGTTCCA
CCATTACCTC GGGTTGGAAG CTGCAGATCT TCTCAAGTTT TCTATGTAGA AATTTTTTAG CTATATGTAA TGTAGTATCT
GCTTCTTGAT TAATTAAGCA GGCGAATTCT TGTTTTTTTT TCTCTTCTAG TTTTGTCAAA TTATTAGTAC TAGTTTCAGT
TTGATAAGGT TAATATCGGA GTTCTGCTAG CTACTGGCCT ACTGTTCTAT AAGCATGTGT ATACAGACAG TCTGAATGCC
GTATGAACTT CTTTCTAAAT GTTTCAATTC AAGTTTGTTC ATCTCG

Locus: Os02g0252200

Loading...

Locus: Os02g0252200

Loading...