Os02t0255100-01

Locus

Os02g0255100

Description

Mitochondrial protein phosphatase 2C protein 13, Pollen germination

RAP-DB Gene Symbol Synonym(s)

DCW11, DCW11, OsPP2C13, PP2C13, OsPP22

RAP-DB Gene Name Synonym(s)

DOWN-REGULATED GENE 11, Probable protein phosphatase 2C 13, protein phosphatase 2C 13, protein phosphatase 2C13, protein phosphatase 22

CGSNL Gene Symbol

DCW11

CGSNL Gene Name

DOWN-REGULATED GENE 11

Oryzabase Gene Symbol Synonym(s)

DCW11, OsPP2C13, PP2C13, OsPP22

Oryzabase Gene Name Synonym(s)

Probable protein phosphatase 2C 13, protein phosphatase 2C 13, protein phosphatase 2C13, protein phosphatase 22

Transcript Evidence

AK069289 (Genbank)

Protein Evidence

Q6EN45 (UniProt)

Literature

PMID: 18308761

PMID: 19021904

Note

Manual Curation

June 4, 2009

Gene Ontology (GO)

Biological Process: protein dephosphorylation (GO:0006470)

Cellular Component: protein serine/threonine phosphatase complex (GO:0008287)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: protein serine/threonine phosphatase activity (GO:0004722)

Functional domain (InterPro)

Protein phosphatase 2C, manganese/magnesium aspartate binding site (IPR000222)

Protein phosphatase 2C-like (IPR001932)

Protein phosphatase 2C (IPR015655)

Full-length cDNA

J023012I24 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0255100-01)

RiceXPro (AK069289)

Others

Oryzabase (8232)

KEGG (Os02t0255100-01 (EC:3.1.3.16))

Transcript

1470 bp

>Os02t0255100-01 Mitochondrial protein phosphatase 2C protein 13, Pollen germination
GGATCTCGCCTCGATCGCGGCGGTGGCGGTGGGGAGGGGAGCGCACCGCCTGCCCAGCCA
TGAGATGGTATGCTTCGCTAGCCTGAGGAGGGCTCTGCCTCTGCTGCTGCGCGCCACCAC
CACCACCACCCCCCGCTTCCTTCTCCCCAGGGCCCTCTCCGGCGGCGTTGGCGGCGGGGC
GGCGGTGGATGCGCGCGCGCTTCTCCGTGGGCACAGCGGGTGGCGCGGGCTCCGGGTGGC
CGCCAGGATGATGCTCGACTCCTCCGACTCCGCCGCCGCTGCGGGGCAGATGCAGCCGCA
GCAGCGTGCGGCGGGGGCCGTCGCCTGCAGCGCGCAGGACGGTGGTGCCGCAGGGTACGC
CAGCGGCGGGTGGGCGAGAGAAGATGGTAAACTGAAATGTGGATATTCAAGTTTTAGAGG
GAAGAGAGCCACCATGGAGGATTTCTATGATGTAAAGTTAACTGAAATCGATGGACAGGC
TGTTAGCCTATTTGGTGTATTTGATGGTCATGGAGGACCACGTGCTGCTGAGTATTTGAA
GGAAAATTTGTTCGAAAATCTTCTGAAACACCCTGAGTTCCTGACAGATACAAAGCTTGC
CATAAGTGAAACATATCAGAAAACAGATACAGATTTCTTAGAATCAGAATCCAATGCCTT
CAGGGATGATGGTTCAACAGCTTCCACTGCAGTTTTGGTGGGTGGCCATCTATATGTAGC
AAATGTTGGTGATTCCCGTGCTGTTGTTTCAAAAGCTGGTAAAGCTATGGCACTGTCAGA
AGATCACAAACCTAACAGGAGTGATGAGCGGAAGAGAATTGAAAATGCAGGAGGAGTTGT
CATTTGGGCTGGTACTTGGAGGGTAGGAGGTGTACTGGCAATGTCGCGTGCATTTGGCAA
TCGTCTACTGAAGCCATTTGTGGTGGCAGAGCCTGAAATTCAGGAAGAACTTGTCAATGA
AGACTTGGAATGCCTCGTTCTTGCTAGCGATGGACTTTGGGATGTCGTGGAAAATGAGGA
AGCTGTTTCCCTTGCGAAAACAGAAGACCTGCCTGAGTCGGTGGCTAGGAAACTCACGGA
AATAGCCTATTCTCGAGGCAGCGCTGACAACATTACATGCATCGTGGTGCAATTTCACCA
TGATAAAACTGAATAATAAGATGGGACTAGAGCTGATGAAAGGTTGAAGGTTTTTCTACT
TCAAGCTACTTTCCAGCAGTCCAACCACAGAGGGGGTTCCCCAGGAGATGTTGCTCCTGT
AGCATTTGCTAAGGATTGTTTCGTTGATTCTTTTCCTTGTGTAGGAATCATTTTTTGTTT
TCAGAGGTGTTACGAACAGAAAATTTTATTTCGAGTGTAACACACAGTTTTAATTGGATG
GATACTAATAAATCAATTGCTTGTTTACCTAATTACCTGCCATTACGGGCATGGCATATA
ATTCTCGATGATATATAGTTCTTTTTTGGC

CDS

1092 bp

>Os02t0255100-01 Mitochondrial protein phosphatase 2C protein 13, Pollen germination
ATGGTATGCTTCGCTAGCCTGAGGAGGGCTCTGCCTCTGCTGCTGCGCGCCACCACCACC
ACCACCCCCCGCTTCCTTCTCCCCAGGGCCCTCTCCGGCGGCGTTGGCGGCGGGGCGGCG
GTGGATGCGCGCGCGCTTCTCCGTGGGCACAGCGGGTGGCGCGGGCTCCGGGTGGCCGCC
AGGATGATGCTCGACTCCTCCGACTCCGCCGCCGCTGCGGGGCAGATGCAGCCGCAGCAG
CGTGCGGCGGGGGCCGTCGCCTGCAGCGCGCAGGACGGTGGTGCCGCAGGGTACGCCAGC
GGCGGGTGGGCGAGAGAAGATGGTAAACTGAAATGTGGATATTCAAGTTTTAGAGGGAAG
AGAGCCACCATGGAGGATTTCTATGATGTAAAGTTAACTGAAATCGATGGACAGGCTGTT
AGCCTATTTGGTGTATTTGATGGTCATGGAGGACCACGTGCTGCTGAGTATTTGAAGGAA
AATTTGTTCGAAAATCTTCTGAAACACCCTGAGTTCCTGACAGATACAAAGCTTGCCATA
AGTGAAACATATCAGAAAACAGATACAGATTTCTTAGAATCAGAATCCAATGCCTTCAGG
GATGATGGTTCAACAGCTTCCACTGCAGTTTTGGTGGGTGGCCATCTATATGTAGCAAAT
GTTGGTGATTCCCGTGCTGTTGTTTCAAAAGCTGGTAAAGCTATGGCACTGTCAGAAGAT
CACAAACCTAACAGGAGTGATGAGCGGAAGAGAATTGAAAATGCAGGAGGAGTTGTCATT
TGGGCTGGTACTTGGAGGGTAGGAGGTGTACTGGCAATGTCGCGTGCATTTGGCAATCGT
CTACTGAAGCCATTTGTGGTGGCAGAGCCTGAAATTCAGGAAGAACTTGTCAATGAAGAC
TTGGAATGCCTCGTTCTTGCTAGCGATGGACTTTGGGATGTCGTGGAAAATGAGGAAGCT
GTTTCCCTTGCGAAAACAGAAGACCTGCCTGAGTCGGTGGCTAGGAAACTCACGGAAATA
GCCTATTCTCGAGGCAGCGCTGACAACATTACATGCATCGTGGTGCAATTTCACCATGAT
AAAACTGAATAA

Protein

363 aa

>Os02t0255100-01 Mitochondrial protein phosphatase 2C protein 13, Pollen germination
MVCFASLRRALPLLLRATTTTTPRFLLPRALSGGVGGGAAVDARALLRGHSGWRGLRVAA
RMMLDSSDSAAAAGQMQPQQRAAGAVACSAQDGGAAGYASGGWAREDGKLKCGYSSFRGK
RATMEDFYDVKLTEIDGQAVSLFGVFDGHGGPRAAEYLKENLFENLLKHPEFLTDTKLAI
SETYQKTDTDFLESESNAFRDDGSTASTAVLVGGHLYVANVGDSRAVVSKAGKAMALSED
HKPNRSDERKRIENAGGVVIWAGTWRVGGVLAMSRAFGNRLLKPFVVAEPEIQEELVNED
LECLVLASDGLWDVVENEEAVSLAKTEDLPESVARKLTEIAYSRGSADNITCIVVQFHHD
KTE*

5'UTR

chr02:8760067..8760130 (+ strand) : 64 bp

CDS

chr02:8760131..8760444 (+ strand) : 314 bp

chr02:8763776..8763903 (+ strand) : 128 bp

chr02:8763983..8764081 (+ strand) : 99 bp

chr02:8764197..8764355 (+ strand) : 159 bp

chr02:8764936..8765022 (+ strand) : 87 bp

chr02:8765259..8765350 (+ strand) : 92 bp

chr02:8765567..8765641 (+ strand) : 75 bp

chr02:8765817..8765954 (+ strand) : 138 bp

3'UTR

chr02:8765955..8766268 (+ strand) : 314 bp

FASTA

>Os02t0255100-01 class=Sequence position=chr02:8760067..8766268 (+ strand)
GGATCTCGCC TCGATCGCGG CGGTGGCGGT GGGGAGGGGA GCGCACCGCC TGCCCAGCCA TGAGATGGTA TGCTTCGCTA
GCCTGAGGAG GGCTCTGCCT CTGCTGCTGC GCGCCACCAC CACCACCACC CCCCGCTTCC TTCTCCCCAG GGCCCTCTCC
GGCGGCGTTG GCGGCGGGGC GGCGGTGGAT GCGCGCGCGC TTCTCCGTGG GCACAGCGGG TGGCGCGGGC TCCGGGTGGC
CGCCAGGATG ATGCTCGACT CCTCCGACTC CGCCGCCGCT GCGGGGCAGA TGCAGCCGCA GCAGCGTGCG GCGGGGGCCG
TCGCCTGCAG CGCGCAGGAC GGTGGTGCCG CAGGGTACGC CAGCGGCGGG TGGGCGAGGT AATAATGATA ATAATAATAA
TAATAATGAA TAATGCGTGT CTTTACACTT TCATGGTTAT TATAGCTCTA TGTATCTGTT TCGATCCTAA ACCATCTCGT
TTTCGCCTCT AGTGTGAAAT GAACCGTGTT GGCATTTGAA TGTGGTCCTT TGCGCTGGGG AATTGGTTTG GTTTGTTCAG
TTGTCCTGTG GTGGTAGCCA ATTAGCATGA AGAAACCTGC TAGGCCCCAA ATATGAAGGA TGCAAATGTA GCAGATATTC
TGATTGCTAT TAATGGCTTA GTGGATTGGT TCTGCATGAT ATTATTCGCG CCTGTACAAT TTTGTGAAAT AGTTAATGCG
TGAAAAGCTT ATCGTAAAAC AGTAATGCTC TAAAAGGTGG TAATTGCGTG CTCAGCACTA TTCTTTGCTT ATAGATAACA
ATCTTCCATT TTTGTGGCAA TGTGCCGATG CGTATGGATG ATTTTTATGT AGATACCGGA AGTAGTATAT ACATATGCAA
TGAGTTAGGG GCTGTTTGAT TTTAAGCCCT AAGCTGACAA ACCAAAGTTT GGCAATGCAC ATGCTTTTTT GTCCTCCATT
TGGCTGGTGA CCACAATTTG TGTGCCCTCT CTATTTGGCA AAGGTAGGCA ATAATTTGTG TGCTCTCTCT ATTTGGCAAA
GGTAGGCAAT AGACTTACCA AACTTTTGGG GACAAAATTT GAATGGCAAT ATCTGACCAA ATTTTGGTGG CTTAGCCTAT
CTCCATGCCC ATATAAAAAA ATATTGGTAA AACCAAAACA TGTTTTTTTG CTACTTTTTT CTCTAGGCAC ACATTTAGTC
ACGGTTATTA GATTTCAATT GGACTTATAG ATGATATATA TATATAATTA TAGAAGACCT TAGTTTTGTA TGATGCACAA
CAAGGGCGAG GTATGAACCC ATGATGGCAT AAAAATCCAT TGCCTAGTAA GATTTAAGAA TGTGCCAGCT TTTGAATTTA
TGATTATAAA GATTTAAGTA CAAGAGAGGA GGCCCTATTG GACATATGAG CTTAGTTCCA AGAAGATCGT TATGAGTGGA
TTTTTACAGC GGATGAAGAA ACATGGTATT TGCCATACTA AAGTTTATAA ACCGAAGAGT ATCCCAATCA CCCAAACAAC
CAAACAATAC TTGTTTGAAT ATCCACCATA AAAAGTTTGG TTCACTTTCA TGCCACAAAA AATGTTGAAG CCATCTCAGA
TCAGACATAT CACTTTGTTC CCTTCCATCC AAACTCCTGA CTCACTAATG TTGACTCATG CCTAGGCCAT GTTCCATCTA
GTCTACTACC TAAACCCAGT CGTTCTGTGC TCCTTTGGTC CTTCCCCAGA ATTCTGTTCC TGCATCATCT TCACAGTTAA
TGTCCTGCAG GTATGATGTT TGTGTACCCA CTCAAAATTA TAAGGACATA ATTACTCCTA AGAGACCAAA TATAGGACTA
CATACATGAT TAAATAGCTA ATACACGATC TTCCTCATAA TATCGCCTGC TGCATTCATC AGCCAAAATG AGCAAAGCTC
ACTGAAATCC TTAGCTCCTG TCTTTAACAT ACTCAAACTG GGAAGTTAGT GGCCATGGCA GCATGACTGG AGCGATAGGT
TGTGCCTCTT ACATATGGTT GCGATGGAGT CACTATCTCA GCATGGAAGA GCACAGTGAG GGTGAAATCA TTTGATATGA
CACTGATTCT CACTTAGCAG GGAGGGCGCA GTGATGTGCT TGTAGATGGA CATGGCATTT TGGAGATTGC GGGGTACTAG
GAGTAAGAAA GTAGGTAATG CAGTGGCTCA AGAGACAAGC GGAGCTTCAG TGAAGAAAGA GTGTAGGGAG GAGCAGGTCT
GGTTGAGCCA TTAAATATGA TGGGGGCCTG GTGATAAGTT GCCATCAGAG ACTTTGGATG GAAGATACCA TAGTGGTATC
AGAGAGTTGC GAAGCTTTGG TTGTTTTTGG TGAACTAGAC TTTTTATGGT ATTTATGAAA AACAAAAACA TTTCGGGCTC
CTTGGAAGTT GAATGCTGAA ATTTCACAGG AGTTTCATAG AGGCAGTTTA CATCCAACAG GAATCAGGAA AAAAAATTCC
ATGTTCAAAG GAGACCTTAG GTTATATACT TGATGTTCTC CTTAAAAAGC CATGCAAATA GGGATggata atgagcaagt
ttggctcgtt agacttggct ggtcaggttc attatgataa ggagccaact tggatcagct cattaacctt aacgagctaa
aagactggct cggcttattt tgctaacttg agctggctcg ttagcaagct agaaatgttc aaacatgtca tgtacaattt
aatatttacc aatttatcat atattagcaa aatagtagca ccaagttatc atatattagt aaaatattta ttaaatataa
aAGGATATGA AGTAATTCTG ACATTAAGTA ATACAAATAG AATGGTCTTT TATACAAACA TGCTTAATGA GTAGCTTGCA
aactggctgg cttggtattg gctgattaag ctaacgagct aaacagccag tttggcttgg cttgtttaga aCATGAGTTC
AAGCTGAACT GGTCCACGAG CTTTGAGCGT TTTGTTCACC CCTACATGGG AACTCCAAAA AGGGTACATA TGCAACATGC
CCTTAGGGGC ATGCTATTGT ACAAGTAGGT CAATTGATTA GTGTTGTCAA GAAAAGTAGG CTCCTATTTA CATGATTGCA
TCACAGCCAT ATGGTACTAG TGGCGCTCAA ATATATGTTT TCTTAACTTT GGATATACAT TGAGCACCAA AAGAGGTGTA
AGCAAGTTAC TTTTGACCAA ACTATGCACC TTTTTTAGGA AACTGTCAGT CATACATTTC AAGCAAACCA GTACTTTATG
CCATAATTTA TGTGATTCCC ATACTTTTGT ATTGACCTTT TCTTTCTCAA TTTTGGTAAA GAATTTGAGC ACTTGACCTA
GTCCTGCATT AATAAGAAGA CTGAATTGTG CGATGGATCC CATTCCTTGG AATATGAAGT AGTTCTATAA GTCTGTGCTT
ACACAATCAT GATGGCCTCT TATTCTAGTT TTTTCCTGCA TCCTATTTTG ACTGCCTTAA AGGCTTAAAC ATACCATGTT
TGTTCAACAT GCAATCATGA CCGAATATAT CAGAGTTTAC AATGTGATCT CTTTTGCTGG AATATGGGAC AATTAATTTT
ATCTCCAATG TTTAAATTTC CATCTCTTTA CAAGAATCAT TCATTCTCTT TGGACTCATT ATTTGACATG CTACCTTGGT
TAACGTAATG TCCGAAAAAT TTGTGACAGA GAAGATGGTA AACTGAAATG TGGATATTCA AGTTTTAGAG GGAAGAGAGC
CACCATGGAG GATTTCTATG ATGTAAAGTT AACTGAAATC GATGGACAGG CTGTTAGCCT ATTTGGTGTA TTTGATGGTA
TGGTTTCCAT CTTTCCTTGT CTACTTTCGT GATTCCGTGC CCACCATGTT TTTCTTTTGA AGATTTGGTG CATTAGGTCA
TGGAGGACCA CGTGCTGCTG AGTATTTGAA GGAAAATTTG TTCGAAAATC TTCTGAAACA CCCTGAGTTC CTGACAGATA
CAAAGCTTGC CATAAGTAAT TTTTCTCTTT GATTCTTACC TTTCCAGTTC TCTGTTCACC TTTTTTTTAA AGGTTGCTAA
TGATTATTAT CTTCTCAACT TTTGAAAAAA AAATCAAAAC ATAACAACAG GTGAAACATA TCAGAAAACA GATACAGATT
TCTTAGAATC AGAATCCAAT GCCTTCAGGG ATGATGGTTC AACAGCTTCC ACTGCAGTTT TGGTGGGTGG CCATCTATAT
GTAGCAAATG TTGGTGATTC CCGTGCTGTT GTTTCAAAAG CTGGTAAAGG TATGTAACAA CACATGCTTG TTGGATGTAG
TTTTTCATCT GAACAACCAC TTGGATTCTT ATCATTGATA TCTGCTTAAT GTTTCTAAAT TTCCCAGCAT TGATGTTTTT
GTTGAAGAAG TTTGGTACCT AATGTCTCAT ATAAACCCCC CTTGGCCCTT CTGCTAACGA TTATTTCCTG TACCATAATT
TAAGGCTAGT GACAAGGGTT GCTTATTTTC TAGACATTCT GGATCTGATA TCTAGGTGGG ATCTGAATTG GTAACTTAAT
TACTGAACTC TTGAAAGAAC TAAGTTTACC TGCATGGTGC TGTTTCTAAT TTGCTTGGGC ATGTTTGGTT TCCCTTCCCA
ACCTGGCTAG CCTTGGTTCA CTCTACAAAA GTGCACATGG GAGTCCGGTT TCAATACTTT CTAGTTTTTT TATTCAGTTT
ATATTTGTCT TCCCCACCCA TCCATTAACA CCTAAAGTGC CCATGGGACT CCTGTTTCAA TATTTTCTAG TTTTTTTTAT
TCAGTTTATA TTTGTCTTCC ATACCCATCC ATTAACACCT AAAGATTTTC ACTTATTCGT TTTTTCTAGC TATGGCACTG
TCAGAAGATC ACAAACCTAA CAGGAGTGAT GAGCGGAAGA GAATTGAAAA TGCAGGAGGA GTTGTCATTT GGGCTGGTAA
GCTAAATCTT CATTCTTGGA TGCACTGGGC ATAGTTTGCC TTTGTAAGCT CACATGGACA AGGCAGGTTG CACAAGGCTT
GTCCATTTGG TGCCTTCTGA TCTCCTTGTA GTTTATGTTA GGTTCTCTAT GTCATACCTG GGTTGTTTAG CATTGCAGCC
TTATTTACCT AAAATCATGC CATCTCTGTA TATATTTTTC TGTTTGTTTT TTAAAAGTGA GTTTATTCCC AGGTACTTGG
AGGGTAGGAG GTGTACTGGC AATGTCGCGT GCATTTGGCA ATCGTCTACT GAAGCCATTT GTGGTGGCAG AGCCTGAAAT
TCAGGTATCT TATTGCACTT AATCATGCTA TGATTTGTAG GCCTCATTTT ATGTAGTTTA ACCTACTCTA GTTAAAGGCT
TAGCCTAGTC TAGATGAAAG TCAGAATAGG AGGTATTTGC AGTTCAACTT GTCTCTTTGT ATGACTCCTC TGCTGTATAA
TTCTGATCAT GACCATATAG CTTGTGTGTG AAGCTTGATT AATGTCTTAA GAAATTACAG GAAGAACTTG TCAATGAAGA
CTTGGAATGC CTCGTTCTTG CTAGCGATGG ACTTTGGGAT GTCGTGGAAA ATGAGGTAAT AAACCACCAA GCACATTATC
TCAACCTGAA AACGATTCGA ATTTCTCAAT GAAACCACTG CTGCTTATGT AGCATTGAAC AAAGCATCAC TTTATTGTCT
TCTCTGTCTG ATCTGGGTAT ACATTTTTAA TGATTGCTAA ATTCTCTGAT AATTCTGTTT ACCAAAATAG GAAGCTGTTT
CCCTTGCGAA AACAGAAGAC CTGCCTGAGT CGGTGGCTAG GAAACTCACG GAAATAGCCT ATTCTCGAGG CAGCGCTGAC
AACATTACAT GCATCGTGGT GCAATTTCAC CATGATAAAA CTGAATAATA AGATGGGACT AGAGCTGATG AAAGGTTGAA
GGTTTTTCTA CTTCAAGCTA CTTTCCAGCA GTCCAACCAC AGAGGGGGTT CCCCAGGAGA TGTTGCTCCT GTAGCATTTG
CTAAGGATTG TTTCGTTGAT TCTTTTCCTT GTGTAGGAAT CATTTTTTGT TTTCAGAGGT GTTACGAACA GAAAATTTTA
TTTCGAGTGT AACACACAGT TTTAATTGGA TGGATACTAA TAAATCAATT GCTTGTTTAC CTAATTACCT GCCATTACGG
GCATGGCATA TAATTCTCGA TGATATATAG TTCTTTTTTG GC

Locus: Os02g0255100

Loading...

Locus: Os02g0255100

Loading...