Os02t0255100-02

Locus

Os02g0255100

Description

Similar to Catalytic/ protein phosphatase type 2C/ protein serine/threonine phosphatase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

DCW11

CGSNL Gene Name

DOWN-REGULATED GENE 11

Oryzabase Gene Symbol Synonym(s)

DCW11, OsPP2C13, PP2C13, OsPP22

Oryzabase Gene Name Synonym(s)

Probable protein phosphatase 2C 13, protein phosphatase 2C 13, protein phosphatase 2C13, protein phosphatase 22

Transcript Evidence

AK060458 (DDBJ, Best hit)

Protein Evidence

B6TEB8 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: catalytic activity (GO:0003824)

Functional domain (InterPro)

Protein phosphatase 2C-like (IPR001932)

Protein phosphatase 2C (IPR015655)

Full-length cDNA

001-012-A11 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0255100-02)

RiceXPro (AK060458)

Others

Oryzabase (8232)

KEGG (Os02t0255100-02 (EC:3.1.3.16))

Transcript

618 bp

>Os02t0255100-02 Similar to Catalytic/ protein phosphatase type 2C/ protein serine/threonine phosphatase.
TAACAGGAGTGATGAGCGGAAGAGAATTGAAAATGCAGGAGGAGTTGTCATTTGGGCTGG
TACTTGGAGGGTAGGAGGTGTACTGGCAATGTCGCGTGCATTTGGCAATCGTCTACTGAA
GCCATTTGTGGTGGCAGAGCCTGAAATTCAGGAAGAACTTGTCAATGAAGACTTGGAATG
CCTCGTTCTTGCTAGCGATGGACTTTGGGATGTCGTGGAAAATGAGGAAGCTGTTTCCCT
TGCGAAAACAGAAGACCTGCCTGAGTCGGTGGCTAGGAAACTCACGGAAATAGCCTATTC
TCGAGGCAGCGCTGACAACATTACATGCATCGTGGTGCAATTTCACCATGATAAAACTGA
ATAATAAGATGGGACTAGAGCTGATGAAAGGTTGAAGGTTTTTCTACTTCAAGCTACTTT
CCAGCAGTCCAACCACAGAGGGGGTTCCCCAGGAGATGTTGCTCCTGTAGCATTTGCTAA
GGATTGTTTCGTTGATTCTTTTCCTTGTGTAGGAATCATTTTTTGTTTTCAGAGGTGTTA
CGAACAGAAAATTTTATTTCGAGTGTAACACACAGTTTTAATTGGATGGATACTAATAAA
TCAATTGCTTGTTTACCT

CDS

363 bp

>Os02t0255100-02 Similar to Catalytic/ protein phosphatase type 2C/ protein serine/threonine phosphatase.
AACAGGAGTGATGAGCGGAAGAGAATTGAAAATGCAGGAGGAGTTGTCATTTGGGCTGGT
ACTTGGAGGGTAGGAGGTGTACTGGCAATGTCGCGTGCATTTGGCAATCGTCTACTGAAG
CCATTTGTGGTGGCAGAGCCTGAAATTCAGGAAGAACTTGTCAATGAAGACTTGGAATGC
CTCGTTCTTGCTAGCGATGGACTTTGGGATGTCGTGGAAAATGAGGAAGCTGTTTCCCTT
GCGAAAACAGAAGACCTGCCTGAGTCGGTGGCTAGGAAACTCACGGAAATAGCCTATTCT
CGAGGCAGCGCTGACAACATTACATGCATCGTGGTGCAATTTCACCATGATAAAACTGAA
TAA

Protein

120 aa

>Os02t0255100-02 Similar to Catalytic/ protein phosphatase type 2C/ protein serine/threonine phosphatase.
NRSDERKRIENAGGVVIWAGTWRVGGVLAMSRAFGNRLLKPFVVAEPEIQEELVNEDLEC
LVLASDGLWDVVENEEAVSLAKTEDLPESVARKLTEIAYSRGSADNITCIVVQFHHDKTE
*

5'UTR

chr02:8764964..8764964 (+ strand) : 1 bp

CDS

chr02:8764965..8765022 (+ strand) : 58 bp

chr02:8765259..8765350 (+ strand) : 92 bp

chr02:8765567..8765641 (+ strand) : 75 bp

chr02:8765817..8765954 (+ strand) : 138 bp

3'UTR

chr02:8765955..8766208 (+ strand) : 254 bp

FASTA

>Os02t0255100-02 class=Sequence position=chr02:8764964..8766208 (+ strand)
TAACAGGAGT GATGAGCGGA AGAGAATTGA AAATGCAGGA GGAGTTGTCA TTTGGGCTGG TAAGCTAAAT CTTCATTCTT
GGATGCACTG GGCATAGTTT GCCTTTGTAA GCTCACATGG ACAAGGCAGG TTGCACAAGG CTTGTCCATT TGGTGCCTTC
TGATCTCCTT GTAGTTTATG TTAGGTTCTC TATGTCATAC CTGGGTTGTT TAGCATTGCA GCCTTATTTA CCTAAAATCA
TGCCATCTCT GTATATATTT TTCTGTTTGT TTTTTAAAAG TGAGTTTATT CCCAGGTACT TGGAGGGTAG GAGGTGTACT
GGCAATGTCG CGTGCATTTG GCAATCGTCT ACTGAAGCCA TTTGTGGTGG CAGAGCCTGA AATTCAGGTA TCTTATTGCA
CTTAATCATG CTATGATTTG TAGGCCTCAT TTTATGTAGT TTAACCTACT CTAGTTAAAG GCTTAGCCTA GTCTAGATGA
AAGTCAGAAT AGGAGGTATT TGCAGTTCAA CTTGTCTCTT TGTATGACTC CTCTGCTGTA TAATTCTGAT CATGACCATA
TAGCTTGTGT GTGAAGCTTG ATTAATGTCT TAAGAAATTA CAGGAAGAAC TTGTCAATGA AGACTTGGAA TGCCTCGTTC
TTGCTAGCGA TGGACTTTGG GATGTCGTGG AAAATGAGGT AATAAACCAC CAAGCACATT ATCTCAACCT GAAAACGATT
CGAATTTCTC AATGAAACCA CTGCTGCTTA TGTAGCATTG AACAAAGCAT CACTTTATTG TCTTCTCTGT CTGATCTGGG
TATACATTTT TAATGATTGC TAAATTCTCT GATAATTCTG TTTACCAAAA TAGGAAGCTG TTTCCCTTGC GAAAACAGAA
GACCTGCCTG AGTCGGTGGC TAGGAAACTC ACGGAAATAG CCTATTCTCG AGGCAGCGCT GACAACATTA CATGCATCGT
GGTGCAATTT CACCATGATA AAACTGAATA ATAAGATGGG ACTAGAGCTG ATGAAAGGTT GAAGGTTTTT CTACTTCAAG
CTACTTTCCA GCAGTCCAAC CACAGAGGGG GTTCCCCAGG AGATGTTGCT CCTGTAGCAT TTGCTAAGGA TTGTTTCGTT
GATTCTTTTC CTTGTGTAGG AATCATTTTT TGTTTTCAGA GGTGTTACGA ACAGAAAATT TTATTTCGAG TGTAACACAC
AGTTTTAATT GGATGGATAC TAATAAATCA ATTGCTTGTT TACCT

Locus: Os02g0255100

Loading...

Locus: Os02g0255100

Loading...