Os02t0259100-01

Locus

Os02g0259100

Description

Conserved hypothetical protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

IIP2

CGSNL Gene Name

ILA1 INTERACTING PROTEIN 2

Oryzabase Gene Symbol Synonym(s)

IIP2

Oryzabase Gene Name Synonym(s)

ILA1 interacting protein 2

Transcript Evidence

AK068099 (DDBJ, Best hit)

Protein Evidence

Q6K245 (UniProt)

Literature

Note

Manual Curation

Full-length cDNA

J013134G20 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0259100-01)

RiceXPro (AK068099)

Others

Oryzabase (10223)

KEGG (Os02t0259100-01)

Transcript

2369 bp

>Os02t0259100-01 Conserved hypothetical protein.
TCTTCTCGGCTCCATTTTTCCCCATCCCGACATCGCATCACCGCCTCTCTCTTTCCCCCC
CCCCCCCCCCCCCCACCTCACCTGCGTCCTCGCCGCCATCGCCGCCGCCGCCGTCGCAGC
ATCGGGATATCCTCCCGCCGCGAGTTTGCTGAGCACAGTTGCTGAATTTTAGGGTTATCT
GCTTCAAGCATAAGTGGGCCATTGCTTCTGGCTTTTACTGAACGTAACTCACTTGGCCAA
ATGAAATCCATGGTAGTTGGTTATTCTGAAGCATAGAATTGTTACTGCTTTGTGAACGAA
TAACATCTATCTATCTAGAGCACTGGAAGATGGATCATAGAGATACTTCTGGGTTTGTCA
GTGGAGGTTGCAAAGAATCAACGAACTGCATCACCCTAGGATTTCTAACTTTTTAGCTTT
GTTAACCATTATTTAATCTGGAAGTGAGGTTATCTGGTACTTGGCAAAAAAATTGGCTGT
GTTTTGTCTCCTGAGAAATTCTCTAGCAATGGACCCCAGACTTGGGCGGTCAGCGTTTAT
AAATTTCTCAAATCCAAATGCCTATGTGGGCAAGTTCCCTGTCATCTCCACAGTCAGCCA
TCCTACAGCTTCTAGTCAAATTGATGTGCTAGCTCATTGCAGTTCATACAACCTGCCTAG
AGGGACCAAGAGAAAGTTTGATGGCTTGTCACTAGGGCTGGGCAACTCATCAAGCTCAGA
ATCTAGCAAGCAAAGCATGGGTACTGGCTGCACCATATCTTCTGCTAAGGGTAGTGATGA
TGGTTCTTCTATTGATTTGGATTTGAATCATTTTACTCTGGGCAATGAAGGTACTTCCAG
GCTTGATAAGCGGGCCTGTGATTCTAGGAGGGCTTTGGATAAGCCTGAATTGAATCTTGA
GCTGTCTTTGTCATCCCAGTCTGCTATTACTGGTGCAGACTTCACTGCAGCGACTGAATA
TAATAGCCCAAGTCTGCAGCCATACTATATGGACTTAGTGCCAACAGTTGATGAAGGATC
TACATCTGCTCGCCGACCATCTGGTTGTCAGGTACTGTCTTTCCTTAATAAGACTGCAAA
GATGAGTGAATTTTCTCCAAGGGAGGTTTTCCCAGGTAGCTCTAACCAGAGTCAAGGTCC
GGCTCCAATGCCAACATTGCTTCAACTGCCAAAAAGTCCAGTAGCCTGTACTTCCGGTTT
ATCTCGTCCACAACAGCGCAGCAGTAGCACAAAAAACTGTACATACCCAGGATGTATGAA
AGGAGCCAGAGGTTCTTCAGGGCGTTGCATTGCTCATGGTGGGGGTAGAAGGTGCCAAAA
AGATGGTTGTGACAAGGGGGCTGAGGGCAAGACAATATTTTGTAAGGCCCATGGTGGGGG
AAGGCGCTGCGAACACCTTGGATGCACCAAGAGTGCTGAAGGTCGTACTGACTTCTGCAT
AGCTCACGGTGGTGGCCGTCGTTGTAGCCATGAAGGATGCAAAAGAGCAGCAAGAGGGAA
ATCTGGTCGCTGTATTAAACATGGTGGTGGCAAAAGGTGTCAACATGCAGGCTGTACAAA
GAAGTGCAAGAGGCCGTACTGACCGCTGTGTTGGCCATGGCGGGGGCAAGAGATGCCAAT
CTTCTGGATGTGATAAGAGTGCACAGGGAAGCACTAACTTTTGCAAGGCACATGGAGGCG
GCAAGCGTTGCTTGTGGGGTCACGAAGGATCTGACCATGGAGCTGGTGACACTCCTTGTG
AGCGCCTTGCAAGAGGCAAGAATGGCCTGTGTGTTTATCACAATCCGCAGGTGGATGAAA
ATCGTGTCCATGGGGGTTTCAGCGTTGTCAGCGATGCACTTTCTCAGGGAGATCGACCTT
CAAACACTGAAACAAGCAGGTGCAGCATTTTCTCGCATCCTATGGAGGCTCCTCGTCGTG
TGGCAGCTCCAGCTGACGAGGGTCGGGTGCATGGTGGCAACATCCTGTCAATGTTTGCAA
ATGGCATGAGTTTGGGGAAGCATCCCGCCAACCAAGCAGAGGCTAGCACCTCTGCACCTC
GCAACTCGAAATCCACCAATGGCATGGTGACCGGTAACTCTGCGGTGCGGGGCAGCTGGC
TGTAGAGCCTTGAACCGCCTTCTGCTCTCTCCATTTCAGTAAGCATATGCTTCGAACCAT
CTGACAAGTGCCTTCTCTTCTTAATCCTTCGGGTGTGAAAACTATGGTGTGATTGTGTGA
ACTGTTGTGTCCTGATTTGTTTAGCAGTGTTGTGAACTTGTGATATATTATTAATCGTTT
GTGCTTTGTAAAATGTAATAATCACCTGTGTGAGATAAATAAAAGGGGGAAGGTTACACA
TTAGATGCTGAATTTCAGGTCTTGTACTG

CDS

1074 bp

>Os02t0259100-01 Conserved hypothetical protein.
ATGGACCCCAGACTTGGGCGGTCAGCGTTTATAAATTTCTCAAATCCAAATGCCTATGTG
GGCAAGTTCCCTGTCATCTCCACAGTCAGCCATCCTACAGCTTCTAGTCAAATTGATGTG
CTAGCTCATTGCAGTTCATACAACCTGCCTAGAGGGACCAAGAGAAAGTTTGATGGCTTG
TCACTAGGGCTGGGCAACTCATCAAGCTCAGAATCTAGCAAGCAAAGCATGGGTACTGGC
TGCACCATATCTTCTGCTAAGGGTAGTGATGATGGTTCTTCTATTGATTTGGATTTGAAT
CATTTTACTCTGGGCAATGAAGGTACTTCCAGGCTTGATAAGCGGGCCTGTGATTCTAGG
AGGGCTTTGGATAAGCCTGAATTGAATCTTGAGCTGTCTTTGTCATCCCAGTCTGCTATT
ACTGGTGCAGACTTCACTGCAGCGACTGAATATAATAGCCCAAGTCTGCAGCCATACTAT
ATGGACTTAGTGCCAACAGTTGATGAAGGATCTACATCTGCTCGCCGACCATCTGGTTGT
CAGGTACTGTCTTTCCTTAATAAGACTGCAAAGATGAGTGAATTTTCTCCAAGGGAGGTT
TTCCCAGGTAGCTCTAACCAGAGTCAAGGTCCGGCTCCAATGCCAACATTGCTTCAACTG
CCAAAAAGTCCAGTAGCCTGTACTTCCGGTTTATCTCGTCCACAACAGCGCAGCAGTAGC
ACAAAAAACTGTACATACCCAGGATGTATGAAAGGAGCCAGAGGTTCTTCAGGGCGTTGC
ATTGCTCATGGTGGGGGTAGAAGGTGCCAAAAAGATGGTTGTGACAAGGGGGCTGAGGGC
AAGACAATATTTTGTAAGGCCCATGGTGGGGGAAGGCGCTGCGAACACCTTGGATGCACC
AAGAGTGCTGAAGGTCGTACTGACTTCTGCATAGCTCACGGTGGTGGCCGTCGTTGTAGC
CATGAAGGATGCAAAAGAGCAGCAAGAGGGAAATCTGGTCGCTGTATTAAACATGGTGGT
GGCAAAAGGTGTCAACATGCAGGCTGTACAAAGAAGTGCAAGAGGCCGTACTGA

Protein

358 aa

>Os02t0259100-01 Conserved hypothetical protein.
MDPRLGRSAFINFSNPNAYVGKFPVISTVSHPTASSQIDVLAHCSSYNLPRGTKRKFDGL
SLGLGNSSSSESSKQSMGTGCTISSAKGSDDGSSIDLDLNHFTLGNEGTSRLDKRACDSR
RALDKPELNLELSLSSQSAITGADFTAATEYNSPSLQPYYMDLVPTVDEGSTSARRPSGC
QVLSFLNKTAKMSEFSPREVFPGSSNQSQGPAPMPTLLQLPKSPVACTSGLSRPQQRSSS
TKNCTYPGCMKGARGSSGRCIAHGGGRRCQKDGCDKGAEGKTIFCKAHGGGRRCEHLGCT
KSAEGRTDFCIAHGGGRRCSHEGCKRAARGKSGRCIKHGGGKRCQHAGCTKKCKRPY*

5'UTR

chr02:8989427..8989570 (- strand) : 144 bp

chr02:8987578..8987653 (- strand) : 76 bp

chr02:8986781..8987068 (- strand) : 288 bp

CDS

chr02:8985727..8986780 (- strand) : 1054 bp

chr02:8985408..8985427 (- strand) : 20 bp

3'UTR

chr02:8984621..8985407 (- strand) : 787 bp

FASTA

>Os02t0259100-01 class=Sequence position=chr02:8984621..8989570 (- strand)
TCTTCTCGGC TCCATTTTTC CCCATCCCGA CATCGCATCA CCGCCTCTCT CTTTCCCCCC CCCCCCCCCC CCCCACCTCA
CCTGCGTCCT CGCCGCCATC GCCGCCGCCG CCGTCGCAGC ATCGGGATAT CCTCCCGCCG CGAGGTGCGT TGCCCTCCCC
TGATCCCCTC CTCCTCCTCC TCCTCCTCCT CCTCCAGGCG TCGTCGTCGT TTCTGCCGCC GGGCTACAGG CCAGGCGATT
TCTTCTTCTT TTCCCCCGCA ATTTCCTTCT TCCTCTTTTT TTTTTTCCGC GCGAATTCAT TGTTTTTCCT GTCGCGGTGG
CGCGCGCTTC CCCCTCTATT TAACCGCGAG GGAGGCCGCG AATTAAGCCT TCCGACTCCG GTCCCGTGCT CCGGAGGTGG
GGTGCAAGGT TTGTGCCCCT GCGTGCTCTC GCTGATGTTT CTAGTGCAAA TTCGTTGGGG CCTGGCTAGG TTGCTTTTTT
AGTGAATTCG TTATGGTATT TGCTGAATCT TCATCGTGTT CTGGGGAGAG TTTCTTTGGA GAAGAGACTA GTTGCGATTG
ATTCTCCATG TTGACAGATG CGCGGCGAGA CGAATTGGAA CGCTTTCTTC TTTTAGATGG TGGTGGGCGT GCTTAGAAAT
TTGTTTGTTG TTAGTGAGTT CGGTTTTTGT TTGCGTTGAC AGTATCTTCT GTTCTAGTTG GTGGACTGTT CTGATTTTGT
TTGGGGAAAA AAAGGAGATC TTTGTGCGGG TTTGAGCCTT GGTTTGGAGG AGCATGGATC CAGCTGTTGA AATACTATAC
GCAGATTTTG CGGTTTTATG AGCAAAAAGT CGGAATAGTC TCTGAATTCA TTATAGTAGT GAACTCATAT TCTTGGATCA
GTTTTGAACT GATGTGCTGT GCAAAAGTAT GATACTGTTT TTACCTTGAT TACTTTCTTC TCTGGAGAGA ACTTTACAGC
GTTGAGGTTG AGATACCGTC CTGGTTACTC TCCTTTTCTT TTTTTTTTCT TTTTGGATAT AAGAAGATTC TGGTGTTTGA
AGGAATGGTA GACTCTTAGA TTTGCTATAT CACTTACAGT TGTTTTCATT AAATCTTCAA ATCATCCTCC CTCTTTCTCA
GAACTTTGAA AGTGATCAGG GCATTGATTG AGCATACATA ATTCAACTAT TAGAGAGTTT TAGAGCAGAT TGATGGTCTA
GCTCCTTGTT TTTGAAAGAT GCACAAAGAT GTTTTAGTAA TTGTACATTT TCTACATTTG AGGGTATTAT CTGGATAATA
ATGAAACCAA ATTCAAATTG CAACAATGAT AGAAATGAAT TTTGAATTAT GGTATCTATG CAGTATAATA TTGCAGCCCT
ATTGATCCTT TGATGGCATA TTTGCTACTT TTTATCCTCT TGAATTTGTT AGGACCTGCT AATATTCCCC TTCCTCGTAT
AAAGCTGTAA GCTTTGGTAT GCATGATTGG AATTTTAAGC ACACATTTCT GTAGCAGAAT ATATGCTCTA TCACTGTCTT
CTTGAAAGTT TTGCTTCTTT TTTATTTGAG CTGTGCCAAA TCTCTTTGTT TTTTTGGAAT ATAGGAGTGT TGGATACTAA
AATTTAGCTA CTCCCCCCCC CCCCCCCCAA ATTGTAGTGA TAGAATCATA GCCGTTACAG ATGACTAGCA GTGTTCTAAG
AGTGTCTTTT AGGTATATAA AAGTGACAGA TTCCCCTACT TGTTGCCATG CTATTGCTAG TTAGGCCACA TTACTGGGTG
GGTTTCACCG AATAATTACA GCTGTGGTGA CCATATGGGT GATTGGATAA ATGTTGGTTA TCTATATTAG AACTTGATTA
CTAGTATTTA CTTATTTGGT TGCTCACATA GTCACAATCC ATGTTGATCA GTCTCTAATA TTGACTTCTA TTTTCAGTTT
GCTGAGCACA GTTGCTGAAT TTTAGGGTTA TCTGCTTCAA GCATAAGTGG GCCATTGCTT CTGGCTTTTA CTGGTAATAA
ACATAGGCTT CAACTTCAAG TTACTCTATC TTAAGGAATT AATAGTTCAT ATATAAGTGC ATTATCGAGC TTGAATTGGC
CTGTTATCAT TGCCGTAACA AAGGATCAGG GTATTTTTTT TGTTTGTAGC TATTTCACTT CAATTGATGA AATTTTACTT
TAGATTTGTT GATGCAACCA GACTTCCTAT ATTTTGTTAA TACACTTGCT ATACAGTAAG TTTGAATCCT GTTTTTATCA
TCTGAATTTT AGACAAAATT TTGGAGTACT CTCTTTTTTA AGAGTACAAC GAAAAGCCAC ACAAACATAT GCCCCTCAAA
TGCATGAGAG GCATGTAGAG ATCCTGCTAT CATATGAACT TTTGTATCTT CTCTTCATGT GTGTAGCAGC ATATAACATC
CTAATTTTCT TTATATGTGT TTGTTGTCCT CTTTTTTTTT TGTGTGTATG AGTTGTATTA TCATGATCAT TGATCATATC
TTTGTCCTTT TGTTATCTGC AGAACGTAAC TCACTTGGCC AAATGAAATC CATGGTAGTT GGTTATTCTG AAGCATAGAA
TTGTTACTGC TTTGTGAACG AATAACATCT ATCTATCTAG AGCACTGGAA GATGGATCAT AGAGATACTT CTGGGTTTGT
CAGTGGAGGT TGCAAAGAAT CAACGAACTG CATCACCCTA GGATTTCTAA CTTTTTAGCT TTGTTAACCA TTATTTAATC
TGGAAGTGAG GTTATCTGGT ACTTGGCAAA AAAATTGGCT GTGTTTTGTC TCCTGAGAAA TTCTCTAGCA ATGGACCCCA
GACTTGGGCG GTCAGCGTTT ATAAATTTCT CAAATCCAAA TGCCTATGTG GGCAAGTTCC CTGTCATCTC CACAGTCAGC
CATCCTACAG CTTCTAGTCA AATTGATGTG CTAGCTCATT GCAGTTCATA CAACCTGCCT AGAGGGACCA AGAGAAAGTT
TGATGGCTTG TCACTAGGGC TGGGCAACTC ATCAAGCTCA GAATCTAGCA AGCAAAGCAT GGGTACTGGC TGCACCATAT
CTTCTGCTAA GGGTAGTGAT GATGGTTCTT CTATTGATTT GGATTTGAAT CATTTTACTC TGGGCAATGA AGGTACTTCC
AGGCTTGATA AGCGGGCCTG TGATTCTAGG AGGGCTTTGG ATAAGCCTGA ATTGAATCTT GAGCTGTCTT TGTCATCCCA
GTCTGCTATT ACTGGTGCAG ACTTCACTGC AGCGACTGAA TATAATAGCC CAAGTCTGCA GCCATACTAT ATGGACTTAG
TGCCAACAGT TGATGAAGGA TCTACATCTG CTCGCCGACC ATCTGGTTGT CAGGTACTGT CTTTCCTTAA TAAGACTGCA
AAGATGAGTG AATTTTCTCC AAGGGAGGTT TTCCCAGGTA GCTCTAACCA GAGTCAAGGT CCGGCTCCAA TGCCAACATT
GCTTCAACTG CCAAAAAGTC CAGTAGCCTG TACTTCCGGT TTATCTCGTC CACAACAGCG CAGCAGTAGC ACAAAAAACT
GTACATACCC AGGATGTATG AAAGGAGCCA GAGGTTCTTC AGGGCGTTGC ATTGCTCATG GTGGGGGTAG AAGGTGCCAA
AAAGATGGTT GTGACAAGGG GGCTGAGGGC AAGACAATAT TTTGTAAGGC CCATGGTGGG GGAAGGCGCT GCGAACACCT
TGGATGCACC AAGAGTGCTG AAGGTCGTAC TGACTTCTGC ATAGCTCACG GTGGTGGCCG TCGTTGTAGC CATGAAGGAT
GCAAAAGAGC AGCAAGAGGG AAATCTGGTC GCTGTATTAA ACATGGTGGT GGCAAAAGGT GTCAACATGC AGGCTGTACA
AAGAGTGCAG AAGGGCGCTC AGGCTTGTGC ATTGCTCATG GAGGTGGGCG CCGCTGTCAG CAAGATGGTT GCGGAAAAGG
AGCTCAGGGA AGTACCAACT TTTGCAAGGC GCATGGTGGT GGGAAGAGAT GCACACACCC TGATTGTAAA AAGGGTGCCG
AGGGAAGTAC AGCGTTTTGC AAGGGACATG GAGGAGGCAA ACGTTGTTCA GCTGAAGGTT GTACTAAGAG TGTGCATGGC
GGAACCCTTT GCTGTGTTGC CCATGGAGGT GGGAAGAGGT GTGTGGTAGA AGGATGCACA AAGAGTGCAA GAGGCCGTAC
TGACCGCTGT GTTGGCCATG GCGGGGGCAA GAGATGCCAA TCTTCTGGAT GTGATAAGAG TGCACAGGGA AGCACTAACT
TTTGCAAGGC ACATGGAGGC GGCAAGCGTT GCTTGTGGGG TCACGAAGGA TCTGACCATG GAGCTGGTGA CACTCCTTGT
GAGCGCCTTG CAAGAGGCAA GAATGGCCTG TGTGTTTATC ACAATCCGCA GGTGGATGAA AATCGTGTCC ATGGGGGTTT
CAGCGTTGTC AGCGATGCAC TTTCTCAGGG AGATCGACCT TCAAACACTG AAACAAGCAG GTGCAGCATT TTCTCGCATC
CTATGGAGGC TCCTCGTCGT GTGGCAGCTC CAGCTGACGA GGGTCGGGTG CATGGTGGCA ACATCCTGTC AATGTTTGCA
AATGGCATGA GTTTGGGGAA GCATCCCGCC AACCAAGCAG AGGCTAGCAC CTCTGCACCT CGCAACTCGA AATCCACCAA
TGGCATGGTG ACCGGTAACT CTGCGGTGCG GGGCAGCTGG CTGTAGAGCC TTGAACCGCC TTCTGCTCTC TCCATTTCAG
TAAGCATATG CTTCGAACCA TCTGACAAGT GCCTTCTCTT CTTAATCCTT CGGGTGTGAA AACTATGGTG TGATTGTGTG
AACTGTTGTG TCCTGATTTG TTTAGCAGTG TTGTGAACTT GTGATATATT ATTAATCGTT TGTGCTTTGT AAAATGTAAT
AATCACCTGT GTGAGATAAA TAAAAGGGGG AAGGTTACAC ATTAGATGCT GAATTTCAGG TCTTGTACTG 

Locus: Os02g0259100

Loading...

Locus: Os02g0259100

Loading...