Os02t0259100-02

Locus

Os02g0259100

Description

Similar to predicted protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

IIP2

CGSNL Gene Name

ILA1 INTERACTING PROTEIN 2

Oryzabase Gene Symbol Synonym(s)

IIP2

Oryzabase Gene Name Synonym(s)

ILA1 interacting protein 2

Transcript Evidence

AK100409 (DDBJ, Best hit)

Protein Evidence

Q6K246 (UniProt)

Literature

Note

Manual Curation

Full-length cDNA

J023087H04 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0259100-02)

RiceXPro (AK100409)

Others

Oryzabase (10223)

KEGG (Os02t0259100-02)

Transcript

2584 bp

>Os02t0259100-02 Similar to predicted protein.
CCCCCCCCCCCCCCCCCACCTCACCTGCGTCCTCGCCGCCATCGCCGCCGCCGCCGTCGC
AGCATCGGGATATCCTCCCGCCGCGAGTTTGCTGAGCACAGTTGCTGAATTTTAGGGTTA
TCTGCTTCAAGCATAAGTGGGCCATTGCTTCTGGCTTTTACTGAACGTAACTCACTTGGC
CAAATGAAATCCATGGTAGTTGGTTATTCTGAAGCATAGAATTGTTACTGCTTTGTGAAC
GAATAACATCTATCTATCTAGAGCACTGGAAGATGGATCATAGAGATACTTCTGGGTTTG
TCAGTGGAGGTTGCAAAGAATCAACGAACTGCATCACCCTAGGATTTCTAACTTTTTAGC
TTTGTTAACCATTATTTAATCTGGAAGTGAGGTTATCTGGTACTTGGCAAAAAAATTGGC
TGTGTTTTGTCTCCTGAGAAATTCTCTAGCAATGGACCCCAGACTTGGGCGGTCAGCGTT
TATAAATTTCTCAAATCCAAATGCCTATGTGGGCAAGTTCCCTGTCATCTCCACAGTCAG
CCATCCTACAGCTTCTAGTCAAATTGATGTGCTAGCTCATTGCAGTTCATACAACCTGCC
TAGAGGGACCAAGAGAAAGTTTGATGGCTTGTCACTAGGGCTGGGCAACTCATCAAGCTC
AGAATCTAGCAAGCAAAGCATGGGTACTGGCTGCACCATATCTTCTGCTAAGGGTAGTGA
TGATGGTTCTTCTATTGATTTGGATTTGAATCATTTTACTCTGGGCAATGAAGGTACTTC
CAGGCTTGATAAGCGGGCCTGTGATTCTAGGAGGGCTTTGGATAAGCCTGAATTGAATCT
TGAGCTGTCTTTGTCATCCCAGTCTGCTATTACTGGTGCAGACTTCACTGCAGCGACTGA
ATATAATAGCCCAAGTCTGCAGCCATACTATATGGACTTAGTGCCAACAGTTGATGAAGG
ATCTACATCTGCTCGCCGACCATCTGGTTGTCAGGTACTGTCTTTCCTTAATAAGACTGC
AAAGATGAGTGAATTTTCTCCAAGGGAGGTTTTCCCAGGTAGCTCTAACCAGAGTCAAGG
TCCGGCTCCAATGCCAACATTGCTTCAACTGCCAAAAAGTCCAGTAGCCTGTACTTCCGG
TTTATCTCGTCCACAACAGCGCAGCAGTAGCACAAAAAACTGTACATACCCAGGATGTAT
GAAAGGAGCCAGAGGTTCTTCAGGGCGTTGCATTGCTCATGGTGGGGGTAGAAGGTGCCA
AAAAGATGGTTGTGACAAGGGGGCTGAGGGCAAGACAATATTTTGTAAGGCCCATGGTGG
GGGAAGGCGCTGCGAACACCTTGGATGCACCAAGAGTGCTGAAGGTCGTACTGACTTCTG
CATAGCTCACGGTGGTGGCCGTCGTTGTAGCCATGAAGGATGCAAAAGAGCAGCAAGAGG
GAAATCTGGTCGCTGTATTAAACATGGTGGTGGCAAAAGGTGTCAACATGCAGGCTGTAC
AAAGAGTGCAGAAGGGCGCTCAGGCTTGTGCATTGCTCATGGAGGTGGGCGCCGCTGTCA
GCAAGATGGTTGCGGAAAAGGAGCTCAGGGAAGTACCAACTTTTGCAAGGCGCATGGTGG
TGGGAAGAGATGCACACACCCTGATTGTAAAAAGGGTGCCGAGGGAAGTACAGCGTTTTG
CAAGGGACATGGAGGAGGCAAACGTTGTTCAGCTGAAGGTTGTACTAAGAGTGTGCATGG
CGGAACCCTTTGCTGTGTTGCCCATGGAGGTGGGAAGAGGTGTGTGGTAGAAGGATGCAC
AAAGAGTGCAAGAGGCCGTACTGACCGCTGTGTTGGCCATGGCGGGGGCAAGAGATGCCA
ATCTTCTGGATGTGATAAGAGTGCACAGGGAAGCACTAACTTTTGCAAGGCACATGGAGG
CGGCAAGCGTTGCTTGTGGGGTCACGAAGGATCTGACCATGGAGCTGGTGACACTCCTTG
TGAGCGCCTTGCAAGAGGCAAGAATGGCCTGTGTGTTTATCACAATCCGCAGGTGGATGA
AAATCGTGTCCATGGGGGTTTCAGCGTTGTCAGCGATGCACTTTCTCAGGGAGATCGACC
TTCAAACACTGAAACAAGCAGGTGCAGCATTTTCTCGCATCCTATGGAGGCTCCTCGTCG
TGTGGCAGCTCCAGCTGACGAGGGTCGGGTGCATGGTGGCAACATCCTGTCAATGTTTGC
AAATGGCATGAGTTTGGGGAAGCATCCCGCCAACCAAGCAGAGGCTAGCACCTCTGCACC
TCGCAACTCGAAATCCACCAATGGCATGGTGACCGGTAACTCTGCGGTGCGGGGCAGCTG
GCTGTAGAGCCTTGAACCGCCTTCTGCTCTCTCCATTTCAGTAAGCATATGCTTCGAACC
ATCTGACAAGTGCCTTCTCTTCTTAATCCTTCGGGTGTGAAAACTATGGTGTGATTGTGT
GAACTGTTGTGTCCTGATTTGTTTAGCAGTGTTGTGAACTTGTGATATATTATTAATCGT
TTGTGCTTTGTAAAATGTAATAATCACCTGTGTGAGATAAATAAAAGGGGGAAGGTTACA
CATT

CDS

1896 bp

>Os02t0259100-02 Similar to predicted protein.
ATGGACCCCAGACTTGGGCGGTCAGCGTTTATAAATTTCTCAAATCCAAATGCCTATGTG
GGCAAGTTCCCTGTCATCTCCACAGTCAGCCATCCTACAGCTTCTAGTCAAATTGATGTG
CTAGCTCATTGCAGTTCATACAACCTGCCTAGAGGGACCAAGAGAAAGTTTGATGGCTTG
TCACTAGGGCTGGGCAACTCATCAAGCTCAGAATCTAGCAAGCAAAGCATGGGTACTGGC
TGCACCATATCTTCTGCTAAGGGTAGTGATGATGGTTCTTCTATTGATTTGGATTTGAAT
CATTTTACTCTGGGCAATGAAGGTACTTCCAGGCTTGATAAGCGGGCCTGTGATTCTAGG
AGGGCTTTGGATAAGCCTGAATTGAATCTTGAGCTGTCTTTGTCATCCCAGTCTGCTATT
ACTGGTGCAGACTTCACTGCAGCGACTGAATATAATAGCCCAAGTCTGCAGCCATACTAT
ATGGACTTAGTGCCAACAGTTGATGAAGGATCTACATCTGCTCGCCGACCATCTGGTTGT
CAGGTACTGTCTTTCCTTAATAAGACTGCAAAGATGAGTGAATTTTCTCCAAGGGAGGTT
TTCCCAGGTAGCTCTAACCAGAGTCAAGGTCCGGCTCCAATGCCAACATTGCTTCAACTG
CCAAAAAGTCCAGTAGCCTGTACTTCCGGTTTATCTCGTCCACAACAGCGCAGCAGTAGC
ACAAAAAACTGTACATACCCAGGATGTATGAAAGGAGCCAGAGGTTCTTCAGGGCGTTGC
ATTGCTCATGGTGGGGGTAGAAGGTGCCAAAAAGATGGTTGTGACAAGGGGGCTGAGGGC
AAGACAATATTTTGTAAGGCCCATGGTGGGGGAAGGCGCTGCGAACACCTTGGATGCACC
AAGAGTGCTGAAGGTCGTACTGACTTCTGCATAGCTCACGGTGGTGGCCGTCGTTGTAGC
CATGAAGGATGCAAAAGAGCAGCAAGAGGGAAATCTGGTCGCTGTATTAAACATGGTGGT
GGCAAAAGGTGTCAACATGCAGGCTGTACAAAGAGTGCAGAAGGGCGCTCAGGCTTGTGC
ATTGCTCATGGAGGTGGGCGCCGCTGTCAGCAAGATGGTTGCGGAAAAGGAGCTCAGGGA
AGTACCAACTTTTGCAAGGCGCATGGTGGTGGGAAGAGATGCACACACCCTGATTGTAAA
AAGGGTGCCGAGGGAAGTACAGCGTTTTGCAAGGGACATGGAGGAGGCAAACGTTGTTCA
GCTGAAGGTTGTACTAAGAGTGTGCATGGCGGAACCCTTTGCTGTGTTGCCCATGGAGGT
GGGAAGAGGTGTGTGGTAGAAGGATGCACAAAGAGTGCAAGAGGCCGTACTGACCGCTGT
GTTGGCCATGGCGGGGGCAAGAGATGCCAATCTTCTGGATGTGATAAGAGTGCACAGGGA
AGCACTAACTTTTGCAAGGCACATGGAGGCGGCAAGCGTTGCTTGTGGGGTCACGAAGGA
TCTGACCATGGAGCTGGTGACACTCCTTGTGAGCGCCTTGCAAGAGGCAAGAATGGCCTG
TGTGTTTATCACAATCCGCAGGTGGATGAAAATCGTGTCCATGGGGGTTTCAGCGTTGTC
AGCGATGCACTTTCTCAGGGAGATCGACCTTCAAACACTGAAACAAGCAGGTGCAGCATT
TTCTCGCATCCTATGGAGGCTCCTCGTCGTGTGGCAGCTCCAGCTGACGAGGGTCGGGTG
CATGGTGGCAACATCCTGTCAATGTTTGCAAATGGCATGAGTTTGGGGAAGCATCCCGCC
AACCAAGCAGAGGCTAGCACCTCTGCACCTCGCAACTCGAAATCCACCAATGGCATGGTG
ACCGGTAACTCTGCGGTGCGGGGCAGCTGGCTGTAG

Protein

632 aa

>Os02t0259100-02 Similar to predicted protein.
MDPRLGRSAFINFSNPNAYVGKFPVISTVSHPTASSQIDVLAHCSSYNLPRGTKRKFDGL
SLGLGNSSSSESSKQSMGTGCTISSAKGSDDGSSIDLDLNHFTLGNEGTSRLDKRACDSR
RALDKPELNLELSLSSQSAITGADFTAATEYNSPSLQPYYMDLVPTVDEGSTSARRPSGC
QVLSFLNKTAKMSEFSPREVFPGSSNQSQGPAPMPTLLQLPKSPVACTSGLSRPQQRSSS
TKNCTYPGCMKGARGSSGRCIAHGGGRRCQKDGCDKGAEGKTIFCKAHGGGRRCEHLGCT
KSAEGRTDFCIAHGGGRRCSHEGCKRAARGKSGRCIKHGGGKRCQHAGCTKSAEGRSGLC
IAHGGGRRCQQDGCGKGAQGSTNFCKAHGGGKRCTHPDCKKGAEGSTAFCKGHGGGKRCS
AEGCTKSVHGGTLCCVAHGGGKRCVVEGCTKSARGRTDRCVGHGGGKRCQSSGCDKSAQG
STNFCKAHGGGKRCLWGHEGSDHGAGDTPCERLARGKNGLCVYHNPQVDENRVHGGFSVV
SDALSQGDRPSNTETSRCSIFSHPMEAPRRVAAPADEGRVHGGNILSMFANGMSLGKHPA
NQAEASTSAPRNSKSTNGMVTGNSAVRGSWL*

5'UTR

chr02:8989427..8989513 (- strand) : 87 bp

chr02:8987578..8987653 (- strand) : 76 bp

chr02:8986781..8987068 (- strand) : 288 bp

CDS

chr02:8984885..8986780 (- strand) : 1896 bp

3'UTR

chr02:8984648..8984884 (- strand) : 237 bp

FASTA

>Os02t0259100-02 class=Sequence position=chr02:8984648..8989513 (- strand)
CCCCCCCCCC CCCCCCCACC TCACCTGCGT CCTCGCCGCC ATCGCCGCCG CCGCCGTCGC AGCATCGGGA TATCCTCCCG
CCGCGAGGTG CGTTGCCCTC CCCTGATCCC CTCCTCCTCC TCCTCCTCCT CCTCCTCCAG GCGTCGTCGT CGTTTCTGCC
GCCGGGCTAC AGGCCAGGCG ATTTCTTCTT CTTTTCCCCC GCAATTTCCT TCTTCCTCTT TTTTTTTTTC CGCGCGAATT
CATTGTTTTT CCTGTCGCGG TGGCGCGCGC TTCCCCCTCT ATTTAACCGC GAGGGAGGCC GCGAATTAAG CCTTCCGACT
CCGGTCCCGT GCTCCGGAGG TGGGGTGCAA GGTTTGTGCC CCTGCGTGCT CTCGCTGATG TTTCTAGTGC AAATTCGTTG
GGGCCTGGCT AGGTTGCTTT TTTAGTGAAT TCGTTATGGT ATTTGCTGAA TCTTCATCGT GTTCTGGGGA GAGTTTCTTT
GGAGAAGAGA CTAGTTGCGA TTGATTCTCC ATGTTGACAG ATGCGCGGCG AGACGAATTG GAACGCTTTC TTCTTTTAGA
TGGTGGTGGG CGTGCTTAGA AATTTGTTTG TTGTTAGTGA GTTCGGTTTT TGTTTGCGTT GACAGTATCT TCTGTTCTAG
TTGGTGGACT GTTCTGATTT TGTTTGGGGA AAAAAAGGAG ATCTTTGTGC GGGTTTGAGC CTTGGTTTGG AGGAGCATGG
ATCCAGCTGT TGAAATACTA TACGCAGATT TTGCGGTTTT ATGAGCAAAA AGTCGGAATA GTCTCTGAAT TCATTATAGT
AGTGAACTCA TATTCTTGGA TCAGTTTTGA ACTGATGTGC TGTGCAAAAG TATGATACTG TTTTTACCTT GATTACTTTC
TTCTCTGGAG AGAACTTTAC AGCGTTGAGG TTGAGATACC GTCCTGGTTA CTCTCCTTTT CTTTTTTTTT TCTTTTTGGA
TATAAGAAGA TTCTGGTGTT TGAAGGAATG GTAGACTCTT AGATTTGCTA TATCACTTAC AGTTGTTTTC ATTAAATCTT
CAAATCATCC TCCCTCTTTC TCAGAACTTT GAAAGTGATC AGGGCATTGA TTGAGCATAC ATAATTCAAC TATTAGAGAG
TTTTAGAGCA GATTGATGGT CTAGCTCCTT GTTTTTGAAA GATGCACAAA GATGTTTTAG TAATTGTACA TTTTCTACAT
TTGAGGGTAT TATCTGGATA ATAATGAAAC CAAATTCAAA TTGCAACAAT GATAGAAATG AATTTTGAAT TATGGTATCT
ATGCAGTATA ATATTGCAGC CCTATTGATC CTTTGATGGC ATATTTGCTA CTTTTTATCC TCTTGAATTT GTTAGGACCT
GCTAATATTC CCCTTCCTCG TATAAAGCTG TAAGCTTTGG TATGCATGAT TGGAATTTTA AGCACACATT TCTGTAGCAG
AATATATGCT CTATCACTGT CTTCTTGAAA GTTTTGCTTC TTTTTTATTT GAGCTGTGCC AAATCTCTTT GTTTTTTTGG
AATATAGGAG TGTTGGATAC TAAAATTTAG CTACTCCCCC CCCCCCCCCC CAAATTGTAG TGATAGAATC ATAGCCGTTA
CAGATGACTA GCAGTGTTCT AAGAGTGTCT TTTAGGTATA TAAAAGTGAC AGATTCCCCT ACTTGTTGCC ATGCTATTGC
TAGTTAGGCC ACATTACTGG GTGGGTTTCA CCGAATAATT ACAGCTGTGG TGACCATATG GGTGATTGGA TAAATGTTGG
TTATCTATAT TAGAACTTGA TTACTAGTAT TTACTTATTT GGTTGCTCAC ATAGTCACAA TCCATGTTGA TCAGTCTCTA
ATATTGACTT CTATTTTCAG TTTGCTGAGC ACAGTTGCTG AATTTTAGGG TTATCTGCTT CAAGCATAAG TGGGCCATTG
CTTCTGGCTT TTACTGGTAA TAAACATAGG CTTCAACTTC AAGTTACTCT ATCTTAAGGA ATTAATAGTT CATATATAAG
TGCATTATCG AGCTTGAATT GGCCTGTTAT CATTGCCGTA ACAAAGGATC AGGGTATTTT TTTTGTTTGT AGCTATTTCA
CTTCAATTGA TGAAATTTTA CTTTAGATTT GTTGATGCAA CCAGACTTCC TATATTTTGT TAATACACTT GCTATACAGT
AAGTTTGAAT CCTGTTTTTA TCATCTGAAT TTTAGACAAA ATTTTGGAGT ACTCTCTTTT TTAAGAGTAC AACGAAAAGC
CACACAAACA TATGCCCCTC AAATGCATGA GAGGCATGTA GAGATCCTGC TATCATATGA ACTTTTGTAT CTTCTCTTCA
TGTGTGTAGC AGCATATAAC ATCCTAATTT TCTTTATATG TGTTTGTTGT CCTCTTTTTT TTTTGTGTGT ATGAGTTGTA
TTATCATGAT CATTGATCAT ATCTTTGTCC TTTTGTTATC TGCAGAACGT AACTCACTTG GCCAAATGAA ATCCATGGTA
GTTGGTTATT CTGAAGCATA GAATTGTTAC TGCTTTGTGA ACGAATAACA TCTATCTATC TAGAGCACTG GAAGATGGAT
CATAGAGATA CTTCTGGGTT TGTCAGTGGA GGTTGCAAAG AATCAACGAA CTGCATCACC CTAGGATTTC TAACTTTTTA
GCTTTGTTAA CCATTATTTA ATCTGGAAGT GAGGTTATCT GGTACTTGGC AAAAAAATTG GCTGTGTTTT GTCTCCTGAG
AAATTCTCTA GCAATGGACC CCAGACTTGG GCGGTCAGCG TTTATAAATT TCTCAAATCC AAATGCCTAT GTGGGCAAGT
TCCCTGTCAT CTCCACAGTC AGCCATCCTA CAGCTTCTAG TCAAATTGAT GTGCTAGCTC ATTGCAGTTC ATACAACCTG
CCTAGAGGGA CCAAGAGAAA GTTTGATGGC TTGTCACTAG GGCTGGGCAA CTCATCAAGC TCAGAATCTA GCAAGCAAAG
CATGGGTACT GGCTGCACCA TATCTTCTGC TAAGGGTAGT GATGATGGTT CTTCTATTGA TTTGGATTTG AATCATTTTA
CTCTGGGCAA TGAAGGTACT TCCAGGCTTG ATAAGCGGGC CTGTGATTCT AGGAGGGCTT TGGATAAGCC TGAATTGAAT
CTTGAGCTGT CTTTGTCATC CCAGTCTGCT ATTACTGGTG CAGACTTCAC TGCAGCGACT GAATATAATA GCCCAAGTCT
GCAGCCATAC TATATGGACT TAGTGCCAAC AGTTGATGAA GGATCTACAT CTGCTCGCCG ACCATCTGGT TGTCAGGTAC
TGTCTTTCCT TAATAAGACT GCAAAGATGA GTGAATTTTC TCCAAGGGAG GTTTTCCCAG GTAGCTCTAA CCAGAGTCAA
GGTCCGGCTC CAATGCCAAC ATTGCTTCAA CTGCCAAAAA GTCCAGTAGC CTGTACTTCC GGTTTATCTC GTCCACAACA
GCGCAGCAGT AGCACAAAAA ACTGTACATA CCCAGGATGT ATGAAAGGAG CCAGAGGTTC TTCAGGGCGT TGCATTGCTC
ATGGTGGGGG TAGAAGGTGC CAAAAAGATG GTTGTGACAA GGGGGCTGAG GGCAAGACAA TATTTTGTAA GGCCCATGGT
GGGGGAAGGC GCTGCGAACA CCTTGGATGC ACCAAGAGTG CTGAAGGTCG TACTGACTTC TGCATAGCTC ACGGTGGTGG
CCGTCGTTGT AGCCATGAAG GATGCAAAAG AGCAGCAAGA GGGAAATCTG GTCGCTGTAT TAAACATGGT GGTGGCAAAA
GGTGTCAACA TGCAGGCTGT ACAAAGAGTG CAGAAGGGCG CTCAGGCTTG TGCATTGCTC ATGGAGGTGG GCGCCGCTGT
CAGCAAGATG GTTGCGGAAA AGGAGCTCAG GGAAGTACCA ACTTTTGCAA GGCGCATGGT GGTGGGAAGA GATGCACACA
CCCTGATTGT AAAAAGGGTG CCGAGGGAAG TACAGCGTTT TGCAAGGGAC ATGGAGGAGG CAAACGTTGT TCAGCTGAAG
GTTGTACTAA GAGTGTGCAT GGCGGAACCC TTTGCTGTGT TGCCCATGGA GGTGGGAAGA GGTGTGTGGT AGAAGGATGC
ACAAAGAGTG CAAGAGGCCG TACTGACCGC TGTGTTGGCC ATGGCGGGGG CAAGAGATGC CAATCTTCTG GATGTGATAA
GAGTGCACAG GGAAGCACTA ACTTTTGCAA GGCACATGGA GGCGGCAAGC GTTGCTTGTG GGGTCACGAA GGATCTGACC
ATGGAGCTGG TGACACTCCT TGTGAGCGCC TTGCAAGAGG CAAGAATGGC CTGTGTGTTT ATCACAATCC GCAGGTGGAT
GAAAATCGTG TCCATGGGGG TTTCAGCGTT GTCAGCGATG CACTTTCTCA GGGAGATCGA CCTTCAAACA CTGAAACAAG
CAGGTGCAGC ATTTTCTCGC ATCCTATGGA GGCTCCTCGT CGTGTGGCAG CTCCAGCTGA CGAGGGTCGG GTGCATGGTG
GCAACATCCT GTCAATGTTT GCAAATGGCA TGAGTTTGGG GAAGCATCCC GCCAACCAAG CAGAGGCTAG CACCTCTGCA
CCTCGCAACT CGAAATCCAC CAATGGCATG GTGACCGGTA ACTCTGCGGT GCGGGGCAGC TGGCTGTAGA GCCTTGAACC
GCCTTCTGCT CTCTCCATTT CAGTAAGCAT ATGCTTCGAA CCATCTGACA AGTGCCTTCT CTTCTTAATC CTTCGGGTGT
GAAAACTATG GTGTGATTGT GTGAACTGTT GTGTCCTGAT TTGTTTAGCA GTGTTGTGAA CTTGTGATAT ATTATTAATC
GTTTGTGCTT TGTAAAATGT AATAATCACC TGTGTGAGAT AAATAAAAGG GGGAAGGTTA CACATT

Locus: Os02g0259100

Loading...

Locus: Os02g0259100

Loading...