Os02t0272200-00

Locus

Os02g0272200

Description

Similar to Flavin-binding monooxygenase-like family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

YUCCA12

CGSNL Gene Name

YUCCA-LIKE GENE 12

Oryzabase Gene Symbol Synonym(s)

OsYUCCA12, OsYUC12

Oryzabase Gene Name Synonym(s)

Transcript Evidence

tplb0009m23 (Wheat FLcDNA)

Protein Evidence

Q2R929 (UniProt)

Literature

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: flavin-containing monooxygenase activity (GO:0004499)

Molecular Function: oxidoreductase activity (GO:0016491)

Molecular Function: flavin adenine dinucleotide binding (GO:0050660)

Molecular Function: NADP binding (GO:0050661)

Functional domain (InterPro)

Pyridine nucleotide-disulphide oxidoreductase, class-II (IPR000103)

FAD-dependent pyridine nucleotide-disulphide oxidoreductase (IPR013027)

Flavin monooxygenase-like (IPR020946)

Expression Databases

TENOR (Os02t0272200-00)

Others

Oryzabase (9110)

Transcript

1181 bp

>Os02t0272200-00 Similar to Flavin-binding monooxygenase-like family protein.
ATGGAGGAGGTGGTTGTTCtcatcatcggtgcggggccggcaggcctagcgacggcagca
tgcctcacattgcaacatgtcgcctatgccattattgagcgtgagtcatgcaccgcatcg
ttatggcgccaccgtacctatgaccgcctcaaattgcacctcgccaaggaattctgcgag
ttgccacacatggcgtatccctctggcacgccgacatacgtccccagggagagttttgtg
gaatacctagacagctacactgaccgatttgggatccaaccaaggtacgatacctctgtc
gagtcagcaacatatgatcaaggaaagaagcattgggctgtgctagcacaggacactgac
accggtgttgtagcaagactcactgcacggttcctcatcatggccaccggtgagaaaagc
gcagcaagcattccactagtccctggcctcgccgggttcgagggagaagctatccactca
tcagcgtacaaatccgggaatggctatactgggaagagtgtgcttgttgttggtgccggg
aactctggcatggagatcgcctacgaccttgccacacatggcgcccacacctccatagtt
gttcgcagcccgGTACACATAATGACAAAAGAACTAATACGTTTTGGGATGACAATGGTG
CAAAATCTAGGCCTATCAGTGACAATTGTGGACCCTCTTCTTGTAATGGCAGCAAAATTA
ATTTTTTGGGACTTGTCAAAGCATGGAATTATGAGGCCTAAAATGGGCCCTCTCTTACTG
AAGTCACAAACTGGCAAATCTGCTGTCATTGATGTCGGCACTGCAAAATTAATCACTAGA
GGAGTTATCGACGTGCTCGAAGGAATATTGAAGATAAATGCAAACAATGTTGAATTTCAT
TGTGGGAGGCAAATTCCATTTGATGCCATTGTGTTTGCCACGGGCTACAAAAGCACAGTT
AATACATGGCTAAAGAATGGTGAAAGCATGTTTAGAAATGATGGTTTTCCCAAGAAAAAA
TTTCCAAATCATTGGAGAGGTGAAAATGGGCTCTATTGTGCTGGGTTTGCAAGGAGAGGA
TTGGTCAGTATTGCCATGGATGCCAAGAATATTGTTGATGACATCAGAGCCACCATGTAT
CAAGTGTCTTGCTAAATTTGGTTCCTTTTGTTTCCAAAGGA

CDS

1155 bp

>Os02t0272200-00 Similar to Flavin-binding monooxygenase-like family protein.
ATGGAGGAGGTGGTTGTTCtcatcatcggtgcggggccggcaggcctagcgacggcagca
tgcctcacattgcaacatgtcgcctatgccattattgagcgtgagtcatgcaccgcatcg
ttatggcgccaccgtacctatgaccgcctcaaattgcacctcgccaaggaattctgcgag
ttgccacacatggcgtatccctctggcacgccgacatacgtccccagggagagttttgtg
gaatacctagacagctacactgaccgatttgggatccaaccaaggtacgatacctctgtc
gagtcagcaacatatgatcaaggaaagaagcattgggctgtgctagcacaggacactgac
accggtgttgtagcaagactcactgcacggttcctcatcatggccaccggtgagaaaagc
gcagcaagcattccactagtccctggcctcgccgggttcgagggagaagctatccactca
tcagcgtacaaatccgggaatggctatactgggaagagtgtgcttgttgttggtgccggg
aactctggcatggagatcgcctacgaccttgccacacatggcgcccacacctccatagtt
gttcgcagcccgGTACACATAATGACAAAAGAACTAATACGTTTTGGGATGACAATGGTG
CAAAATCTAGGCCTATCAGTGACAATTGTGGACCCTCTTCTTGTAATGGCAGCAAAATTA
ATTTTTTGGGACTTGTCAAAGCATGGAATTATGAGGCCTAAAATGGGCCCTCTCTTACTG
AAGTCACAAACTGGCAAATCTGCTGTCATTGATGTCGGCACTGCAAAATTAATCACTAGA
GGAGTTATCGACGTGCTCGAAGGAATATTGAAGATAAATGCAAACAATGTTGAATTTCAT
TGTGGGAGGCAAATTCCATTTGATGCCATTGTGTTTGCCACGGGCTACAAAAGCACAGTT
AATACATGGCTAAAGAATGGTGAAAGCATGTTTAGAAATGATGGTTTTCCCAAGAAAAAA
TTTCCAAATCATTGGAGAGGTGAAAATGGGCTCTATTGTGCTGGGTTTGCAAGGAGAGGA
TTGGTCAGTATTGCCATGGATGCCAAGAATATTGTTGATGACATCAGAGCCACCATGTAT
CAAGTGTCTTGCTAA

Protein

385 aa

>Os02t0272200-00 Similar to Flavin-binding monooxygenase-like family protein.
MEEVVVLIIGAGPAGLATAACLTLQHVAYAIIERESCTASLWRHRTYDRLKLHLAKEFCE
LPHMAYPSGTPTYVPRESFVEYLDSYTDRFGIQPRYDTSVESATYDQGKKHWAVLAQDTD
TGVVARLTARFLIMATGEKSAASIPLVPGLAGFEGEAIHSSAYKSGNGYTGKSVLVVGAG
NSGMEIAYDLATHGAHTSIVVRSPVHIMTKELIRFGMTMVQNLGLSVTIVDPLLVMAAKL
IFWDLSKHGIMRPKMGPLLLKSQTGKSAVIDVGTAKLITRGVIDVLEGILKINANNVEFH
CGRQIPFDAIVFATGYKSTVNTWLKNGESMFRNDGFPKKKFPNHWRGENGLYCAGFARRG
LVSIAMDAKNIVDDIRATMYQVSC*

CDS

chr02:9877605..9878216 (+ strand) : 612 bp

chr02:9878501..9878740 (+ strand) : 240 bp

chr02:9878853..9878975 (+ strand) : 123 bp

chr02:9879097..9879276 (+ strand) : 180 bp

3'UTR

chr02:9879277..9879302 (+ strand) : 26 bp

FASTA

>Os02t0272200-00 class=Sequence position=chr02:9877605..9879302 (+ strand)
ATGGAGGAGG TGGTTGTTCt catcatcggt gcggggccgg caggcctagc gacggcagca tgcctcacat tgcaacatgt
cgcctatgcc attattgagc gtgagtcatg caccgcatcg ttatggcgcc accgtaccta tgaccgcctc aaattgcacc
tcgccaagga attctgcgag ttgccacaca tggcgtatcc ctctggcacg ccgacatacg tccccaggga gagttttgtg
gaatacctag acagctacac tgaccgattt gggatccaac caaggtacga tacctctgtc gagtcagcaa catatgatca
aggaaagaag cattgggctg tgctagcaca ggacactgac accggtgttg tagcaagact cactgcacgg ttcctcatca
tggccaccgg tgagaaaagc gcagcaagca ttccactagt ccctggcctc gccgggttcg agggagaagc tatccactca
tcagcgtaca aatccgggaa tggctatact gggaagagtg tgcttgttgt tggtgccggg aactctggca tggagatcgc
ctacgacctt gccacacatg gcgcccacac ctccatagtt gttcgcagcc cggtaTGTAC ATCATATTTA TTCATCTTGC
ATTTATGCAC TTCATTTTGG GTTCTGATTC TTTGCAAGGT AGACTATCTA AGTAGTGTTG AAATATGGTA GTTCCATTAT
GCATATATAA CTGGGAATTA TCGATGTAGT ACAAAATTTC TCAACGTTTA ACTTTATTTC TATCCAAGAA TATTATTATC
TATCTCTATG TATATTATCC AAGGCCGACT TGTTCTCACT TTCTAGCTAC ATATTCCCCC CTAAATAATA ATGGTTTCAT
GGCAACTTGA ATGCAGGTAC ACATAATGAC AAAAGAACTA ATACGTTTTG GGATGACAAT GGTGCAAAAT CTAGGCCTAT
CAGTGACAAT TGTGGACCCT CTTCTTGTAA TGGCAGCAAA ATTAATTTTT TGGGACTTGT CAAAGCATGG AATTATGAGG
CCTAAAATGG GCCCTCTCTT ACTGAAGTCA CAAACTGGCA AATCTGCTGT CATTGATGTC GGCACTGCAA AATTAATCAC
TAGAGGAGTT ATCGACGTAA TTGTGCATCT ACTCTTAAGA TATAAAAGTA AATTGCTTGG TGATAGTGAA GTTTTTAGCC
TCAATTGATG TGACGAACCT TAACACCGTT GTTTTATGTA TTTATTAGGT GCTCGAAGGA ATATTGAAGA TAAATGCAAA
CAATGTTGAA TTTCATTGTG GGAGGCAAAT TCCATTTGAT GCCATTGTGT TTGCCACGGG CTACAAAAGC ACAGTTAATA
CATGGCTAAA GGTACAAAGA TTATTGGTAG TTTTTTTTTC AAATCTCTTA GTTTAGACAA TAATATTGTT GTAGCATACA
TCATTTTTTT TTCATTACTG CAAATGGATA ATCCTTTTTT TGCTGTTGTC AGAATGGTGA AAGCATGTTT AGAAATGATG
GTTTTCCCAA GAAAAAATTT CCAAATCATT GGAGAGGTGA AAATGGGCTC TATTGTGCTG GGTTTGCAAG GAGAGGATTG
GTCAGTATTG CCATGGATGC CAAGAATATT GTTGATGACA TCAGAGCCAC CATGTATCAA GTGTCTTGCT AAATTTGGTT
CCTTTTGTTT CCAAAGGA

Locus: Os02g0272200

Loading...

Locus: Os02g0272200

Loading...