Os02t0274100-01

Locus

Os02g0274100

Description

3-hydroxyacyl-CoA dehydrogenase, Multifunctional protein, RNA- and microtubule-binding protein, Salicylic acid (SA) biosynthesis, Maintenance of root meristem activity, Beta -oxidation of fatty acids

RAP-DB Gene Symbol Synonym(s)

AIM1, MFP

RAP-DB Gene Name Synonym(s)

ABNORMAL INFLORESCENCE MERISTEM1, multifunctional protein, peroxisomal multifunctional protein

CGSNL Gene Symbol

AIM1

CGSNL Gene Name

ABNORMAL INFLORESCENCE MERISTEM1

Oryzabase Gene Symbol Synonym(s)

MFP, OsAIM, OsCHD, CHD

Oryzabase Gene Name Synonym(s)

multifunctional protein, peroxisomal multifunctional protein, ABNORMAL INFLORESCENCE MERISTEM 1, cinnamoyl-CoA hydratase-dehydrogenase

Transcript Evidence

AK073294

Protein Evidence

Q8W1L6

Literature

PMID: 28298519

PMID: 11706039

Note

Manual Curation

April 18, 2017

Gene Ontology (GO)

Biological Process: fatty acid metabolic process (GO:0006631)

Biological Process: fatty acid beta-oxidation (GO:0006635)

Biological Process: metabolic process (GO:0008152)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: 3-hydroxyacyl-CoA dehydrogenase activity (GO:0003857)

Molecular Function: oxidoreductase activity (GO:0016491)

Cellular Component: peroxisome (GO:0005777)

Functional domain (InterPro)

Crotonase superfamily (IPR001753)

Peroxisomal fatty acid beta-oxidation multifunctional protein AIM1 (IPR033346)

ClpP/crotonase-like domain (IPR029045)

NAD(P)-binding domain (IPR016040)

3-hydroxyacyl-CoA dehydrogenase, NAD binding (IPR006176)

3-hydroxyacyl-CoA dehydrogenase, C-terminal (IPR006108)

6-phosphogluconate dehydrogenase C-terminal domain-like (IPR008927)

6-phosphogluconate dehydrogenase, domain 2 (IPR013328)

Enoyl-CoA hydratase/isomerase, conserved site (IPR018376)

3-hydroxyacyl-CoA dehydrogenase, conserved site (IPR006180)

Full-length cDNA

J033025B12 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0274100-01)

RiceXPro (AK073294)

Others

Oryzabase (13872)

KEGG (Os02t0274100-01 (EC:1.1.1.211)

KEGG ( EC:1.1.1.35)

KEGG ( EC:4.2.1.17))

Transcript

2792 bp

>Os02t0274100-01 3-hydroxyacyl-CoA dehydrogenase, Multifunctional protein,  RNA- and microtubule-binding protein, Salicylic acid (SA) biosynthesis, Maintenance of root meristem activity, Beta -oxidation of fatty acids
CCCGACTCCGAGAGATTACTTCCTCCACCTTCCATCCATCTCCTCTTCTCCCCCTCTCCC
TCTCTCTCTCGAGATCGAACGAACGAAGAACCCTAGGTCATCCATGGCGGGGGCGATCCG
CGTCACCATGGAGGTGGGCGCCGACGGCGTCGCGGTCGTCACCATCTGCAACCCGCCCGT
CAATGCGCTGCATCCCATCATCATCCAGGGATTGAAGGAGAAGTACGCGGAGGCGATGGA
TCGCGACGACGTCAAGGCCATCGTGCTCACCGGTGCTGGAGGCAAATTTTGTGGAGGCTT
TGATATCAATGTGTTCACAGAAGTTCACAAGACTGGAAATGTATCTCTTATGCCTGATGT
ATCTGTTGAGCTTGTGTCGAATTTGATGGAAGCGGGCAAAAAGCCTTCAGTTGCTGCCAT
TCAAGGCCTTGCTCTTGGTGGCGGTTTGGAGTTGACCATGGGTTGCCATGCTCGGATATC
TACCCCTGAAGCTCAACTTGGACTACCAGAGTTGACTCTGGGCATAATTCCTGGATTTGG
AGGAACCCAGCGTCTGCCAAGGCTTGTAGGTCTGCCCAAAGCAATAGAAATGATGCTGCA
ATCAAAGTTCATCACAGCAAAGGAAGGGAAAGAAGGTGGTCTTGTTGATGCCCTGTGCTC
CCCTGATGAGTTGATAAAGATGTCACGCCTTTGGGCTCTGGAGATAGCTAATTACCGTAA
ACCTTGGATAAGATCTCTTGCCAGAACAGATAGGCTTGGTTCACTGtctgaagctcgttc
tgtattaaatagtgcaagacagcaagcgaagaaggttgcagcaaacttgccacagcacca
ggcctgcctagatgttatggaagaaggtgtactatgtggaggccatgctggtgttctgaa
gGAGGCCAAGGTTTTCAAGGAGTTGGTGCTATCACCAACATCAAAGGCACTTGTACATGC
TTTCTTTGCCCAGCGTTTAACCACAAAGGTGCCAGGTGTTACTGATGTTCAATTGAAACC
TAGGAAAATAAGAAAAGTTGCTGTTATTGGTGGTGGTTTGATGGGCTCTGGAATTGCAAC
AGCTCTTCTTGTTAGCAATACATCCGTTGTGCTTAAGGAAGTAAATCCTCAATTCCTGCA
AAGGGGACAGAAGATGATAGCAGCTAATCTTGAGGGTCTAGTCAAGAGGGGCTCATTGAC
AAAGGACAAGATGAACAAGGCCATGTCACTTCTCAAGGGTGCATTGGATTATTCTGATTT
CAAGGATGTTGATATGGTCATCGAGGCTGTCATAGAGAAGATTCCTTTGAAACAATCAAT
ATTTTCTGACCTTGAGAAAGTATGCCCACCCCACTGCATACTTGCAACAAACACATCTAC
CATCGATTTGAATGTTGTGGGCGAGAAGACAAATTCTCAAGATAGAATTATAGGGGCACA
TTTCTTTAGCCCTGCCCATATTATGCCTTTGCTTGAAATTGTCCGGACGGAGAAGACATC
ACCGCAAGCTATTCTTGATCTCATCACAGTTGGGAAAATGATAAAGAAAGTCCCTGTTGT
GGTTGGGAACTGCACAGGCTTCGCAGTCAATCGTACATTTTTCCCTTACACACAGGGTTC
TCATCTTCTAGTTAGTATTGGGATCGACGTTTTCAGAATTGATCGAGTAATAAGCAGCTT
TGGCATGCCAATGGGACCTTTTCAACTGCAAGATCTGGCTGGATATGGAGTGGCATTGGC
AGTAAAGGATATCTATGCGGCTGCCTTTGGAACAAGGAATCTGGACTCTAATCTGGTGGA
TTTGATGGTACAGAATGGACGGCAGGGAAAGAGCAATGGTAAAGGTTATTACCTTTATGA
GAAGGGTGGGAAGCCGAAGCCTGACCCAAGTGTTCAGGTTGTGATTGACGAGTACAGAAG
ATGTGCAAAGACAATGCCTGGTGGAAAGCCTGTTACTTTATCTGATCAAGATATATTGGA
GATGATTTTCTTCCCAGTTGTTAATGAGGCATGCAGGGTCATGGATGAAAATGTTGTGAT
CCGAGCTTCTGATCTTGATATTGCTTCTATCCTTGGGATGGGTTTTCCCAAGTTCAGGGG
TGGTCTTGTCTTTTGGGCTGACACTATTGGAGCACCTTATATACATTCAAAGCTTAGCAA
GTGGACTGAAATTTATGGCGATTTCTTCAAACCATCATCCTATTTGGAAGATAGAGCTAA
AAGAAGCCTACCATTGAGCGCACCAAACGCAACCCAGCAGGCTTCGTCGAGGTCACGCAT
GTGAGATGCTATTTCAGCTGATGGCAGAATAATTGCTTGATGTGCATCGGCACCCTAGTT
GACCCTCATATCTGGGACCTGAAAAAGGAGGTCAGAGCAGTGTTCACCATGTAATCTCTT
TTGGATATTTTGGCCTTTCCGGTTTTCCGAACTGGGTTGCTATGGCAATCGGAGTAATAA
ATGTTGGCTTCGGATGCCACAAAACTGTAACTTTATGGCCGATAGCCTTTTACTCCAGTG
TTACATTAAAATGTATATGGTACAGTGTTTTTTTAACTTGTAGTAAAATAATATGCATGC
TCTCCGAATAGTCATCTCAGCTTCCCAGTTTATTTCACTTAAAACGTAAGGGGGAAGGCA
GTAATCTGACTCACCCAAGTTCGAACGTCTTGCTTTGATTATCAATGTAAGGTGTAAAGT
CTATCATGTAATGTGTTCGTTGTGGTGATGTGTGTGCCCATCTACTACTATGAACAAATG
GAATTTTGGAACCAAGTCAGAGCATTTTACTC

CDS

2181 bp

>Os02t0274100-01 3-hydroxyacyl-CoA dehydrogenase, Multifunctional protein,  RNA- and microtubule-binding protein, Salicylic acid (SA) biosynthesis, Maintenance of root meristem activity, Beta -oxidation of fatty acids
ATGGCGGGGGCGATCCGCGTCACCATGGAGGTGGGCGCCGACGGCGTCGCGGTCGTCACC
ATCTGCAACCCGCCCGTCAATGCGCTGCATCCCATCATCATCCAGGGATTGAAGGAGAAG
TACGCGGAGGCGATGGATCGCGACGACGTCAAGGCCATCGTGCTCACCGGTGCTGGAGGC
AAATTTTGTGGAGGCTTTGATATCAATGTGTTCACAGAAGTTCACAAGACTGGAAATGTA
TCTCTTATGCCTGATGTATCTGTTGAGCTTGTGTCGAATTTGATGGAAGCGGGCAAAAAG
CCTTCAGTTGCTGCCATTCAAGGCCTTGCTCTTGGTGGCGGTTTGGAGTTGACCATGGGT
TGCCATGCTCGGATATCTACCCCTGAAGCTCAACTTGGACTACCAGAGTTGACTCTGGGC
ATAATTCCTGGATTTGGAGGAACCCAGCGTCTGCCAAGGCTTGTAGGTCTGCCCAAAGCA
ATAGAAATGATGCTGCAATCAAAGTTCATCACAGCAAAGGAAGGGAAAGAAGGTGGTCTT
GTTGATGCCCTGTGCTCCCCTGATGAGTTGATAAAGATGTCACGCCTTTGGGCTCTGGAG
ATAGCTAATTACCGTAAACCTTGGATAAGATCTCTTGCCAGAACAGATAGGCTTGGTTCA
CTGtctgaagctcgttctgtattaaatagtgcaagacagcaagcgaagaaggttgcagca
aacttgccacagcaccaggcctgcctagatgttatggaagaaggtgtactatgtggaggc
catgctggtgttctgaagGAGGCCAAGGTTTTCAAGGAGTTGGTGCTATCACCAACATCA
AAGGCACTTGTACATGCTTTCTTTGCCCAGCGTTTAACCACAAAGGTGCCAGGTGTTACT
GATGTTCAATTGAAACCTAGGAAAATAAGAAAAGTTGCTGTTATTGGTGGTGGTTTGATG
GGCTCTGGAATTGCAACAGCTCTTCTTGTTAGCAATACATCCGTTGTGCTTAAGGAAGTA
AATCCTCAATTCCTGCAAAGGGGACAGAAGATGATAGCAGCTAATCTTGAGGGTCTAGTC
AAGAGGGGCTCATTGACAAAGGACAAGATGAACAAGGCCATGTCACTTCTCAAGGGTGCA
TTGGATTATTCTGATTTCAAGGATGTTGATATGGTCATCGAGGCTGTCATAGAGAAGATT
CCTTTGAAACAATCAATATTTTCTGACCTTGAGAAAGTATGCCCACCCCACTGCATACTT
GCAACAAACACATCTACCATCGATTTGAATGTTGTGGGCGAGAAGACAAATTCTCAAGAT
AGAATTATAGGGGCACATTTCTTTAGCCCTGCCCATATTATGCCTTTGCTTGAAATTGTC
CGGACGGAGAAGACATCACCGCAAGCTATTCTTGATCTCATCACAGTTGGGAAAATGATA
AAGAAAGTCCCTGTTGTGGTTGGGAACTGCACAGGCTTCGCAGTCAATCGTACATTTTTC
CCTTACACACAGGGTTCTCATCTTCTAGTTAGTATTGGGATCGACGTTTTCAGAATTGAT
CGAGTAATAAGCAGCTTTGGCATGCCAATGGGACCTTTTCAACTGCAAGATCTGGCTGGA
TATGGAGTGGCATTGGCAGTAAAGGATATCTATGCGGCTGCCTTTGGAACAAGGAATCTG
GACTCTAATCTGGTGGATTTGATGGTACAGAATGGACGGCAGGGAAAGAGCAATGGTAAA
GGTTATTACCTTTATGAGAAGGGTGGGAAGCCGAAGCCTGACCCAAGTGTTCAGGTTGTG
ATTGACGAGTACAGAAGATGTGCAAAGACAATGCCTGGTGGAAAGCCTGTTACTTTATCT
GATCAAGATATATTGGAGATGATTTTCTTCCCAGTTGTTAATGAGGCATGCAGGGTCATG
GATGAAAATGTTGTGATCCGAGCTTCTGATCTTGATATTGCTTCTATCCTTGGGATGGGT
TTTCCCAAGTTCAGGGGTGGTCTTGTCTTTTGGGCTGACACTATTGGAGCACCTTATATA
CATTCAAAGCTTAGCAAGTGGACTGAAATTTATGGCGATTTCTTCAAACCATCATCCTAT
TTGGAAGATAGAGCTAAAAGAAGCCTACCATTGAGCGCACCAAACGCAACCCAGCAGGCT
TCGTCGAGGTCACGCATGTGA

Protein

727 aa

>Os02t0274100-01 3-hydroxyacyl-CoA dehydrogenase, Multifunctional protein,  RNA- and microtubule-binding protein, Salicylic acid (SA) biosynthesis, Maintenance of root meristem activity, Beta -oxidation of fatty acids
MAGAIRVTMEVGADGVAVVTICNPPVNALHPIIIQGLKEKYAEAMDRDDVKAIVLTGAGG
KFCGGFDINVFTEVHKTGNVSLMPDVSVELVSNLMEAGKKPSVAAIQGLALGGGLELTMG
CHARISTPEAQLGLPELTLGIIPGFGGTQRLPRLVGLPKAIEMMLQSKFITAKEGKEGGL
VDALCSPDELIKMSRLWALEIANYRKPWIRSLARTDRLGSLSEARSVLNSARQQAKKVAA
NLPQHQACLDVMEEGVLCGGHAGVLKEAKVFKELVLSPTSKALVHAFFAQRLTTKVPGVT
DVQLKPRKIRKVAVIGGGLMGSGIATALLVSNTSVVLKEVNPQFLQRGQKMIAANLEGLV
KRGSLTKDKMNKAMSLLKGALDYSDFKDVDMVIEAVIEKIPLKQSIFSDLEKVCPPHCIL
ATNTSTIDLNVVGEKTNSQDRIIGAHFFSPAHIMPLLEIVRTEKTSPQAILDLITVGKMI
KKVPVVVGNCTGFAVNRTFFPYTQGSHLLVSIGIDVFRIDRVISSFGMPMGPFQLQDLAG
YGVALAVKDIYAAAFGTRNLDSNLVDLMVQNGRQGKSNGKGYYLYEKGGKPKPDPSVQVV
IDEYRRCAKTMPGGKPVTLSDQDILEMIFFPVVNEACRVMDENVVIRASDLDIASILGMG
FPKFRGGLVFWADTIGAPYIHSKLSKWTEIYGDFFKPSSYLEDRAKRSLPLSAPNATQQA
SSRSRM*

5'UTR

chr02:10001543..10001645 (+ strand) : 103 bp

CDS

chr02:10001646..10001742 (+ strand) : 97 bp

chr02:10001854..10001925 (+ strand) : 72 bp

chr02:10002688..10002750 (+ strand) : 63 bp

chr02:10002854..10002910 (+ strand) : 57 bp

chr02:10003061..10003128 (+ strand) : 68 bp

chr02:10003229..10003310 (+ strand) : 82 bp

chr02:10003419..10003474 (+ strand) : 56 bp

chr02:10003836..10004138 (+ strand) : 303 bp

chr02:10004540..10004626 (+ strand) : 87 bp

chr02:10005356..10005530 (+ strand) : 175 bp

chr02:10005715..10005836 (+ strand) : 122 bp

chr02:10006073..10006236 (+ strand) : 164 bp

chr02:10007103..10007357 (+ strand) : 255 bp

chr02:10007881..10008002 (+ strand) : 122 bp

chr02:10008122..10008243 (+ strand) : 122 bp

chr02:10008354..10008502 (+ strand) : 149 bp

chr02:10009083..10009221 (+ strand) : 139 bp

chr02:10009673..10009720 (+ strand) : 48 bp

3'UTR

chr02:10009721..10010228 (+ strand) : 508 bp

FASTA

>Os02t0274100-01 class=Sequence position=chr02:10001543..10010228 (+ strand)
CCCGACTCCG AGAGATTACT TCCTCCACCT TCCATCCATC TCCTCTTCTC CCCCTCTCCC TCTCTCTCTC GAGATCGAAC
GAACGAAGAA CCCTAGGTCA TCCATGGCGG GGGCGATCCG CGTCACCATG GAGGTGGGCG CCGACGGCGT CGCGGTCGTC
ACCATCTGCA ACCCGCCCGT CAATGCGCTG CATCCCATCA GTAGGCCTCC TCGTTTCTTA ATTTCGATTT CTTCTTCTTT
TTTTTTTTGG TTTACTCGTT TTGTTTCTGA TTCCGTGTGC TCCGATTGGG GGTTTTTGCT GCTCCCTGCA GTCATCCAGG
GATTGAAGGA GAAGTACGCG GAGGCGATGG ATCGCGACGA CGTCAAGGCC ATCGTGCTCA CCGGTGAGGC CTCCTGCTAA
TCGTTTCACC CCCACCCACC TTCCTGCGAA AAATTTATCA GAGAATTAAC CACCTGTATA CAACAACTGA AATATCTGAT
TTTTCTGGTG TGGCGGTCGT CGAATCTCTG CTGATTTTTT TACTTTACTG ATCGATTGCT GTGTGTACGG GTTGACGTAA
TACGAGCGGC GATTTGTTTT GTTGTCTTGC TCGTGATTTT GTTAGATGTG TATGGTTTAA CTGGATCAAG CTATCTTTGG
TCTGTTGTTC TGAGTGGTTG TGGAGTAGTC CCTATCCTAT CATTTGAGCT GATCTTGGTC AACTGGGTTA ATGAGTGTGC
TGCTCCAGCT GTACAAGATT TGCTTTCCTG GTGGTCTGGA ACTCTAGTGG AGCTGCTGAA CTGTAAATGA TGAATGTTGG
ATGCTAATCC GGTAACCTCA CCAAAGTAGA AACTGCAGCA ATGGCAAGTT ATATATAACC CTTGGCAAGT TATAGATCAG
AAGGAACCCA CTTAGTTCTG TACAGGTCCC CTAGGAGATA TTTTTTTCTT CAAACGGTCT TTGCTATTAA AGGGTAGGGA
ATGGCTTGTC CTGAATTCAA GTTGTACATG CCCACCAAAC TTTTGGTTGA AATGTGCCGT TGTGCATTTT AGGAACGCAA
GAGTAAGAAA GGGGATTGTA ATAAATTTTA GTTTGTGAAA GTTGCTACTT TATTTGTTTG TCATACCTGT TGCTTTCCTC
CTAAATTATG TTCAATCCTT ACTAGGTGCT GGAGGCAAAT TTTGTGGAGG CTTTGATATC AATGTGTTCA CAGAAGTTCA
CAAGACTGGT AAATGGTCCT GTCATATGTA CATGTGATTA ATGTTTTGCT CCGAGCTTGC TTCTTATAGC ATATTGCTCA
CTTTCATTAC AAACATGACA TTGGCTTGCA GGAAATGTAT CTCTTATGCC TGATGTATCT GTTGAGCTTG TGTCGAATTT
GATGGAAGGT TGGCCATCTC TACTTCCTAT TTTTGTCATA GTTTCTCACT CCCTCTTATA TCACCAACAT GAGCGCTGGC
ATCCTTTGTG TATATGTGTT TAGTTCTTAC CAAGATTATT ATGCCTGGAT CTGACTATAG AGCTATTTAT ATGTGCAGCG
GGCAAAAAGC CTTCAGTTGC TGCCATTCAA GGCCTTGCTC TTGGTGGCGG TTTGGAGTTG ACCATGGTAT GTGAATTGTT
ATGCAGAATA TTTATCAGTT GATCCCTAAC CTTGCTCAAG GGTTTAATCT AAATTATGTT TATTACATAA ATGACAAATT
CTTCAGGGTT GCCATGCTCG GATATCTACC CCTGAAGCTC AACTTGGACT ACCAGAGTTG ACTCTGGGCA TAATTCCTGG
ATTTGGAGGT ATTAGTGTTT CTTTCTATGT CAGATTGAAC TAGTGCTCCA CTATTCTACA TCCCTTGCTT TGTATTAGTT
CATATCATGA TCTGATTAAG TTTGCTTATT ATGAAGGAAC CCAGCGTCTG CCAAGGCTTG TAGGTCTGCC CAAAGCAATA
GAAATGATGC TGGTGAGTCT AATATATCAT CTGCCTAAGT TAATTAATTG GTCACACTCT CCTAGTAGCA TTCTTTCTAT
CTAATACAGT TTTTGGTCAA AAGCTAAAAA ATGTTCCAAC TAGACAATTG GCCATGTTTT TGCAAATATT TTTTCTTTGG
CAAAATGAGT TATATTCAGC TGATACAGTT TTAACATTTC CGAGGAACAA AATCAAAAAC TGAAAAAGCA TTCTCCATTT
TAAATGGTTG ATGCCTTGTA CTCTCTACCT TCTATCTGAT TTACTATCAT ACTTTTGGGT TATGGTTGTA ATAATTCATG
TCGAACACAA TTTCATATTT TTCAACATGG GATTCATGAT GTTTTGTTCA CAGCAATCAA AGTTCATCAC AGCAAAGGAA
GGGAAAGAAG GTGGTCTTGT TGATGCCCTG TGCTCCCCTG ATGAGTTGAT AAAGATGTCA CGCCTTTGGG CTCTGGAGAT
AGCTAATTAC CGTAAACCTT GGATAAGATC TCTTGCCAGA ACAGATAGGC TTGGTTCACT Gtctgaagct cgttctgtat
taaatagtgc aagacagcaa gcgaagaagg ttgcagcaaa cttgccacag caccaggcct gcctagatgt tatggaagaa
ggtgtactat gtggaggcca tgctggtgtt ctgaaggTTT GTACCTTCCA GCGTTCTCCA TTTATCTTCC TTAAATATGA
GACCGATGCA GCAAGTATGC CCATTTTGCA CTACATTTAG CTACAAAGCT ACCTGGGCAC CTTTTTGACC TCATCAGATC
GTGTGTACTG CGAATGTACT GGATGTTAGA TGCGTTATTC TTGATAAGTT TAAAATCTTT ATGAAAAATC AGGTCCATTG
GGTGAAATTT TTAGAAGAAT GTAGGTTTTC ATCTGATCTT TCTAGATTGA CAAATTAGAA TGGCATTTAT GTTTAAATTG
CTCTTAGGAC ATTGAAAACT GTACAGTAAA ATGTACCAAG TTATATGCTT CTTTGTTTCT TCCACCATTA ACTACAGCTG
ATGTGTTTAT TTACTGAACA TACCTTAATA AATGCAGGAG GCCAAGGTTT TCAAGGAGTT GGTGCTATCA CCAACATCAA
AGGCACTTGT ACATGCTTTC TTTGCCCAGC GTTTAACCAC AAAGGTTACC TTCTAGAGCA TACAATATCA TTTCTTTTTA
TGATGCACTT CATCATTTGT CACTGATGTC TTTGATTTTG CATCAAATCA TTAACTTTCT TACAAATACT TCTAATTCTT
TTGATCTTCT AGATATGTTG CCAATGTCTA GTTACAGACT GTAGCACCTG TTCTTTTGAA TGACATTACC TGGTCTTGTA
TTGGAATAAA TCCATTTTGC AATCCTAAAC TTTTCAAAAG TTTACTTGAT CCTCTGAACT AGGAAATTGA CTATGTATAA
ACCCTATACC TATAAAACTG TGCGGACTTG GTTGCTTCCA GAAGTTGTTG CAGTCGGGTT TTTTTAGTAG ATCTATATGA
TCTTAGAGTG GATTTTGCCA TGTTGGTACT CATGTCAGCA TAAACATTTA AAGGAATAGG TGAAGAAAAA AGAGCTCCAA
TGACTAAATG TGGATGTCGA AATTCTTGAG CTGTATCACT ATCACAAAAA TCTAATGCAT AGCTCGATCC TGTTTTTTCA
ACTATTTGTT TGTGGAGATG AGATTTTAAA CCACATTACC TTGATATTTA TATGGATGCT ATGCAAGTAG GTTCGTAGAT
GGAATAATCT ATATACAACG CATGGAACCC AAGTTTCTGC AGTCACAACA CTTAATACGC CAAAATTTGT TTTACCTTTC
TCTGTTATGG ATTTCTTGGT GCCATTTTAT GACTTATAGT TTATTGTGTG TAGGTGCCAG GTGTTACTGA TGTTCAATTG
AAACCTAGGA AAATAAGAAA AGTTGCTGTT ATTGGTGGTG GTTTGATGGG CTCTGGAATT GCAACAGCTC TTCTTGTTAG
CAATACATCC GTTGTGCTTA AGGAAGTAAA TCCTCAATTC CTGCAAAGGG GACAGAAGAT GATAGCAGGT CATTTTTGTT
AAATTACTGC TGTGTTTCTT GGGATATTAT TTGCCCTCAG TATTTATTTG AGATTTCCTT AGAGTTATAC TGAATGCTGA
CCTTTTTTTT TTGTTATGCT TGTGCTTTAG GATTATCTTT ATCTGTTTTT TCAGTGTTAT ATTACTGATA AGTAGCAGCA
ATTATTTGAC AGCTAATCTT GAGGGTCTAG TCAAGAGGGG CTCATTGACA AAGGACAAGA TGAACAAGGC CATGTCACTT
CTCAAGGGTG CATTGGATTA TTCTGATTTC AAGGATGTTG ATATGGTCAT CGAGGTAATC CCTCATATGT TTTATGGTTC
AAGTTTGGCA TAGTACTTCG TCTGTAGTTA TTGGAAGTCC CTCTGTTGGT TGATGAAGCA TATGACCATG ACAATGTATT
GTGTTTATGA TAATTAACAT TGTTATTAGA TAACTCATTT TATAGTTCTG TAATTCATGT ACACTGTATT TTTCATGGCA
CACAATTGTT TGTTTAGTCT CTTATGACAC CGTTTTTTTT CTTCTTGTAG GCTGTCATAG AGAAGATTCC TTTGAAACAA
TCAATATTTT CTGACCTTGA GAAAGTATGC CCACCCCACT GCATACTTGC AACAAACACA TCTACCATCG ATTTGAATGT
TGTGGGCGAG AAGACAAATT CTCAAGATAG AATTATAGGG GCACATTTCT TTAGGTTTGT TATTTCTTTT CTTATTGATT
TTGATTGCAG CAGATCCTAT CAATTAGCAA TACGAAGTTG CCAATTTGAG TACACTTATG ACCTATGCAT GTAGATTACT
GAAACCCATC TAACTGTGAA GTTCTCGAAC ATTCTCTCCA ATCAAACTCA TAATTTACGA TGGAGTAGGA ACTTATTTTC
TTAGAAGAAA TGAGAATGTG ATGAATATGT TAATGGAGGA AATATCCAGT GGGAACTCCT CAGTGTTGAC ATACAAAGTT
ACAAACCCTG CGTGAAAGTT CTCTATCGTA CTCTTGTTTT TGGAGCGGGG TGGGGGGTGG GGGGGGGGTG CAGGATATAG
GGAGATGAAT GTTCACTTTT AATTTTCCCC ACGATAGTTT ATCTAAGGTC ACTGAAAATT CAGTGTTGAG TTGTTGATTG
TTGTTTATGG CACTTTTATC TGCAAAAGCA TGGCTAATCA TGATATCATG CGAAACCCAG TAGATATAAC AGAATATAGG
TAAGTCAATC CTTGAAATGC ATGAATAATT GGTTCATTTT AACCATGTCA AACTGATCAT TGTATCCCCG AAAGGCAAGC
GGCAGATCAG TATGGCTTAA GTTAATTCTA AGTCAGATGC CTATGACTTC ATAAGCTAGT AGCTTTTGCA AACTTGCAAT
AACTTTTTAT TTGGGATATG TACAGTAGTA ACTTATGTAT GAGCATCACA TAGAATGTAC GGAGAAGCAG GATATAGGCA
TTTATAAATA ACAATAAGTT CTCTTTAGCC TTTCTGGTTT GGACATTATA TCAAACAATC ACACTGTACT TGTTTACTGT
GAGACACCAT GTTCAATTGC TCATGTTATG TTATTTCCAG CCCTGCCCAT ATTATGCCTT TGCTTGAAAT TGTCCGGACG
GAGAAGACAT CACCGCAAGC TATTCTTGAT CTCATCACAG TTGGGAAAAT GATAAAGAAA GTCCCTGTTG TGGTTGGGAA
CTGCACAGGC TTCGCAGTCA ATCGTACATT TTTCCCTTAC ACACAGGGTT CTCATCTTCT AGTTAGTATT GGGATCGACG
TTTTCAGAAT TGATCGAGTA ATAAGCAGCT TTGGCATGCC AATGGGACCT TTTCAGTAAG TGTTCAACTC TATTTTTATA
CATCTTTATG TCGCACTAGA TTATCATCAC AAATATTAGT ATTTGTATTG AAATTTGTTT AAATAGACAA AATAAGATAG
GAAATATGTA GTTTGAATAA ATTCATGGTT TGCGTTTTAT GCCTTATTTA TTTGTATATA GCTTATAGTG AACATTTTTT
TAGTCCAATT CAATTTATTT TTGTGGGCTT TAGTAAGCTA CATCTTTTGA AATGTGATTG GATGCCTCCT CAATAACTCA
ATGGAGGTCA CATTTCCTTT AATTGTTGTA ATGCAACATG TCACTTATAC CTTTGTGCAT AAATATCTAA TCACCTCAAA
TTGCATACCT TCTGTGCATG AACAATTAAC AGTGAGATAT TGTTGTGTGC CTTACCTAGA TTATTTAAAT GAACAGTGCA
GTGCTGGTCC GTTGTTGATT GACCTGTTTT TCTGTAATCA TCATTCCCAA GGGTTTTTAT ATCTAATAAA TCCCCCTCTT
CCCTCTGCAC TCCTGCAGAC TGCAAGATCT GGCTGGATAT GGAGTGGCAT TGGCAGTAAA GGATATCTAT GCGGCTGCCT
TTGGAACAAG GAATCTGGAC TCTAATCTGG TGGATTTGAT GGTACAGAAT GGACGGCAGG GTATGCTTCC TAGCCTGCTT
TTGCTCCTGC GATGCTGTTG GTTGTAGCAG ATAGGATGGA TTGGACAAGA AACAGTAGTC AAACAAAAAA TTGATGTGAA
ATTTCCCTGT ATTTTATAGG AAAGAGCAAT GGTAAAGGTT ATTACCTTTA TGAGAAGGGT GGGAAGCCGA AGCCTGACCC
AAGTGTTCAG GTTGTGATTG ACGAGTACAG AAGATGTGCA AAGACAATGC CTGGTGGAAA GGTTTCCCTC CTTCCCTGCC
TGAGTCATGG ATTTTTCATT TAAAAATTCC CATGCTATCC CAGCTGGTGA TGGAAAAAAT TTCTGACATG GAGACATTAT
CTTGCTTGCA GCCTGTTACT TTATCTGATC AAGATATATT GGAGATGATT TTCTTCCCAG TTGTTAATGA GGCATGCAGG
GTCATGGATG AAAATGTTGT GATCCGAGCT TCTGATCTTG ATATTGCTTC TATCCTTGGG ATGGGTTTTC CCAAGTTCAG
GTAAACAACT GTTGCTTAAG CTTAAGTTGT GTGGTATGTT ATTAGCAGGT GACAATTTAC GTTCACTTGC ATAATCGTCT
TATGTAACTA AATGCTAATA ATTAGCATGC ACTTGAAGTA TGCCTTAGTT GTATCAATAT TTAGATACTT GGATTGAGAT
GCATGTTTGG TTTGTGCACA AATATAACAT ATGGACTTAA AATTTTATCA GAACACTTCT GATATCTAAA CATGAACCTT
ATTTAATCCT TATGTAGGGT AGGGCTGCAT GGCGTATATA TCAAAATAAA TTTATGTTGC TTTATAACGT GGTGTTTAAC
TTTAGCACTT GGAATTCCAC CATAAGGTAT TCCAAATGAG TGTTTATTGC TAAGTTCTGT TACATCATTG TCTAATACCA
AACAACTCTC AAGTTTTATA TTATTATGCA TTCGTGTGAA GCTGTATAAT TTTGTCAATC CATGATACTG TTAGCCGTCA
GTCCTCACAT GTATATTTTG CTTTCCTTTT TCTTTTTGTC GCGCATAAAG TGTTGTGGTT ATTCTGAGTG TTAGTTTAAC
CTTTGATGTT TTTTATGAAG GGGTGGTCTT GTCTTTTGGG CTGACACTAT TGGAGCACCT TATATACATT CAAAGCTTAG
CAAGTGGACT GAAATTTATG GCGATTTCTT CAAACCATCA TCCTATTTGG AAGATAGAGC TAAAAGAAGC CTACCATTGG
TACTCTCTCT CTTCCTCTCT CACTCACACA CAAAGACACA ACGCAGTCTG TTTCTGATGG ATAGTACCCG ATCCTTGCCT
TCCTAATTTT AGTATATGTT GAGTATAGCG GTTGCAATTA TGAATTAGTA TGCTATAGGC AAATATTATA GATCTGCATG
TGTATCGAGT GCATATGATT ATTACAAACA TTTGAGTAGT TTGATGTTCT CACTAGAAAG TATAAATAAT CCTATTAGTA
CATGCAACGA ACGAAGCCTC TGTGTCAGCA CTGACCGCCT TGGTTCAAAA TTGGTTACAT GGTGGGACGA CCATGGGCCC
TGATCATACA GTTCGATTTT GATATTATTA CTGCACCTGC TCATACGCTC ATTCATTGTG CTTCTCGCTT TAGTGTTCTG
TGATGCTCTA TCAGCTTGTT CGATAATTAA TCATGTTACA ATCTCTGCAG AGCGCACCAA ACGCAACCCA GCAGGCTTCG
TCGAGGTCAC GCATGTGAGA TGCTATTTCA GCTGATGGCA GAATAATTGC TTGATGTGCA TCGGCACCCT AGTTGACCCT
CATATCTGGG ACCTGAAAAA GGAGGTCAGA GCAGTGTTCA CCATGTAATC TCTTTTGGAT ATTTTGGCCT TTCCGGTTTT
CCGAACTGGG TTGCTATGGC AATCGGAGTA ATAAATGTTG GCTTCGGATG CCACAAAACT GTAACTTTAT GGCCGATAGC
CTTTTACTCC AGTGTTACAT TAAAATGTAT ATGGTACAGT GTTTTTTTAA CTTGTAGTAA AATAATATGC ATGCTCTCCG
AATAGTCATC TCAGCTTCCC AGTTTATTTC ACTTAAAACG TAAGGGGGAA GGCAGTAATC TGACTCACCC AAGTTCGAAC
GTCTTGCTTT GATTATCAAT GTAAGGTGTA AAGTCTATCA TGTAATGTGT TCGTTGTGGT GATGTGTGTG CCCATCTACT
ACTATGAACA AATGGAATTT TGGAACCAAG TCAGAGCATT TTACTC

Locus: Os02g0274100

Loading...

Locus: Os02g0274100

Loading...