Os02t0274100-02

Locus

Os02g0274100

Description

Similar to Peroxisomal fatty acid beta-oxidation multifunctional protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

AIM1

CGSNL Gene Name

ABNORMAL INFLORESCENCE MERISTEM1

Oryzabase Gene Symbol Synonym(s)

MFP, OsAIM, OsCHD, CHD

Oryzabase Gene Name Synonym(s)

multifunctional protein, peroxisomal multifunctional protein, ABNORMAL INFLORESCENCE MERISTEM 1, cinnamoyl-CoA hydratase-dehydrogenase

Transcript Evidence

AK061665 (DDBJ, Best hit)

Protein Evidence

Q8W1L6 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: fatty acid metabolic process (GO:0006631)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: nucleotide binding (GO:0000166)

Molecular Function: 3-hydroxyacyl-CoA dehydrogenase activity (GO:0003857)

Molecular Function: oxidoreductase activity (GO:0016491)

Molecular Function: oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor (GO:0016616)

Molecular Function: coenzyme binding (GO:0050662)

Functional domain (InterPro)

3-hydroxyacyl-CoA dehydrogenase, C-terminal (IPR006108)

3-hydroxyacyl-CoA dehydrogenase, NAD binding (IPR006176)

3-hydroxyacyl-CoA dehydrogenase, conserved site (IPR006180)

6-phosphogluconate dehydrogenase, C-terminal-like (IPR008927)

Dehydrogenase, multihelical (IPR013328)

NAD(P)-binding domain (IPR016040)

Full-length cDNA

001-036-F01 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0274100-02)

RiceXPro (AK061665)

Others

Oryzabase (13872)

KEGG (Os02t0274100-02 (EC:1.1.1.211, EC:1.1.1.35, EC:4.2.1.17))

Transcript

1259 bp

>Os02t0274100-02 Similar to Peroxisomal fatty acid beta-oxidation multifunctional protein.
AACAATCAATATTTTCTGACCTTGAGAAAGTATGCCCACCCCACTGCATACTTGCAACAA
ACACATCTACCATCGATTTGAATGTTGTGGGCGAGAAGACAAATTCTCAAGATAGAATTA
TAGGGGCACATTTCTTTAGCCCTGCCCATATTATGCCTTTGCTTGAAATTGTCCGGACGG
AGAAGACATCACCGCAAGCTATTCTTGATCTCATCACAGTTGGGAAAATGATAAAGAAAG
TCCCTGTTGTGGTTGGGAACTGCACAGGCTTCGCAGTCAATCGTACATTTTTCCCTTACA
CACAGGGTTCTCATCTTCTAGTTAGTATTGGGATCGACGTTTTCAGAATTGATCGAGTAA
TAAGCAGCTTTGGCATGCCAATGGGACCTTTTCAACTGCAAGATCTGGCTGGATATGGAG
TGGCATTGGCAGTAAAGGATATCTATGCGGCTGCCTTTGGAACAAGGAATCTGGACTCTA
ATCTGGTGGATTTGATGGTACAGAATGGACGGCAGGGAAAGAGCAATGGTAAAGGTTATT
ACCTTTATGAGAAGGGTGGGAAGCCGAAGCCTGACCCAAGTGTTCAGGTTGTGATTGACG
AGTACAGAAGATGTGCAAAGACAATGCCTGGTGGAAAGCCTGTTACTTTATCTGATCAAG
ATATATTGGAGATGATTTTCTTCCCAGTTGTTAATGAGGCATGCAGGGTCATGGATGAAA
ATGTTGTGATCCGAGCTTCTGATCTTGATATTGCTTCTATCCTTGGGATGGGTTTTCCCA
AGTTCAGGGGTGGTCTTGTCTTTTGGGCTGACACTATTGGAGCACCTTATATACATTCAA
AGCTTAGCAAGTGGACTGAAATTTATGGCGATTTCTTCAAACCATCATCCTATTTGGAAG
ATAGAGCTAAAAGAAGCCTACCATTGAGCGCACCAAACGCAACCCAGCAGGCTTCGTCGA
GGTCACGCATGTGAGATGCTATTTCAGCTGATGGCAGAATAATTGCTTGATGTGCATCGG
CACCCTAGTTGACCCTCATATCTGGGACCTGAAAAAGGAGGTCAGAGCAGTGTTCACCAT
GTAATCTCTTTTGGATATTTTGGCCTTTCCGGTTTTCCGAACTGGGTTGCTATGGCAATC
GGAGTAATAAATGTTGGCTTCGGATGCCACAAAACTGTAACTTTATGGCCGATAGCCTTT
TACTCCAGTGTTACATTAAAATGTATATGGTACAGTGTTTTTTTAACTTGTAGTAAAAT

CDS

972 bp

>Os02t0274100-02 Similar to Peroxisomal fatty acid beta-oxidation multifunctional protein.
CAATCAATATTTTCTGACCTTGAGAAAGTATGCCCACCCCACTGCATACTTGCAACAAAC
ACATCTACCATCGATTTGAATGTTGTGGGCGAGAAGACAAATTCTCAAGATAGAATTATA
GGGGCACATTTCTTTAGCCCTGCCCATATTATGCCTTTGCTTGAAATTGTCCGGACGGAG
AAGACATCACCGCAAGCTATTCTTGATCTCATCACAGTTGGGAAAATGATAAAGAAAGTC
CCTGTTGTGGTTGGGAACTGCACAGGCTTCGCAGTCAATCGTACATTTTTCCCTTACACA
CAGGGTTCTCATCTTCTAGTTAGTATTGGGATCGACGTTTTCAGAATTGATCGAGTAATA
AGCAGCTTTGGCATGCCAATGGGACCTTTTCAACTGCAAGATCTGGCTGGATATGGAGTG
GCATTGGCAGTAAAGGATATCTATGCGGCTGCCTTTGGAACAAGGAATCTGGACTCTAAT
CTGGTGGATTTGATGGTACAGAATGGACGGCAGGGAAAGAGCAATGGTAAAGGTTATTAC
CTTTATGAGAAGGGTGGGAAGCCGAAGCCTGACCCAAGTGTTCAGGTTGTGATTGACGAG
TACAGAAGATGTGCAAAGACAATGCCTGGTGGAAAGCCTGTTACTTTATCTGATCAAGAT
ATATTGGAGATGATTTTCTTCCCAGTTGTTAATGAGGCATGCAGGGTCATGGATGAAAAT
GTTGTGATCCGAGCTTCTGATCTTGATATTGCTTCTATCCTTGGGATGGGTTTTCCCAAG
TTCAGGGGTGGTCTTGTCTTTTGGGCTGACACTATTGGAGCACCTTATATACATTCAAAG
CTTAGCAAGTGGACTGAAATTTATGGCGATTTCTTCAAACCATCATCCTATTTGGAAGAT
AGAGCTAAAAGAAGCCTACCATTGAGCGCACCAAACGCAACCCAGCAGGCTTCGTCGAGG
TCACGCATGTGA

Protein

324 aa

>Os02t0274100-02 Similar to Peroxisomal fatty acid beta-oxidation multifunctional protein.
QSIFSDLEKVCPPHCILATNTSTIDLNVVGEKTNSQDRIIGAHFFSPAHIMPLLEIVRTE
KTSPQAILDLITVGKMIKKVPVVVGNCTGFAVNRTFFPYTQGSHLLVSIGIDVFRIDRVI
SSFGMPMGPFQLQDLAGYGVALAVKDIYAAAFGTRNLDSNLVDLMVQNGRQGKSNGKGYY
LYEKGGKPKPDPSVQVVIDEYRRCAKTMPGGKPVTLSDQDILEMIFFPVVNEACRVMDEN
VVIRASDLDIASILGMGFPKFRGGLVFWADTIGAPYIHSKLSKWTEIYGDFFKPSSYLED
RAKRSLPLSAPNATQQASSRSRM*

5'UTR

chr02:10006098..10006099 (+ strand) : 2 bp

CDS

chr02:10006100..10006236 (+ strand) : 137 bp

chr02:10007103..10007357 (+ strand) : 255 bp

chr02:10007881..10008002 (+ strand) : 122 bp

chr02:10008122..10008243 (+ strand) : 122 bp

chr02:10008354..10008502 (+ strand) : 149 bp

chr02:10009083..10009221 (+ strand) : 139 bp

chr02:10009673..10009720 (+ strand) : 48 bp

3'UTR

chr02:10009721..10010005 (+ strand) : 285 bp

FASTA

>Os02t0274100-02 class=Sequence position=chr02:10006098..10010005 (+ strand)
AACAATCAAT ATTTTCTGAC CTTGAGAAAG TATGCCCACC CCACTGCATA CTTGCAACAA ACACATCTAC CATCGATTTG
AATGTTGTGG GCGAGAAGAC AAATTCTCAA GATAGAATTA TAGGGGCACA TTTCTTTAGG TTTGTTATTT CTTTTCTTAT
TGATTTTGAT TGCAGCAGAT CCTATCAATT AGCAATACGA AGTTGCCAAT TTGAGTACAC TTATGACCTA TGCATGTAGA
TTACTGAAAC CCATCTAACT GTGAAGTTCT CGAACATTCT CTCCAATCAA ACTCATAATT TACGATGGAG TAGGAACTTA
TTTTCTTAGA AGAAATGAGA ATGTGATGAA TATGTTAATG GAGGAAATAT CCAGTGGGAA CTCCTCAGTG TTGACATACA
AAGTTACAAA CCCTGCGTGA AAGTTCTCTA TCGTACTCTT GTTTTTGGAG CGGGGTGGGG GGTGGGGGGG GGGTGCAGGA
TATAGGGAGA TGAATGTTCA CTTTTAATTT TCCCCACGAT AGTTTATCTA AGGTCACTGA AAATTCAGTG TTGAGTTGTT
GATTGTTGTT TATGGCACTT TTATCTGCAA AAGCATGGCT AATCATGATA TCATGCGAAA CCCAGTAGAT ATAACAGAAT
ATAGGTAAGT CAATCCTTGA AATGCATGAA TAATTGGTTC ATTTTAACCA TGTCAAACTG ATCATTGTAT CCCCGAAAGG
CAAGCGGCAG ATCAGTATGG CTTAAGTTAA TTCTAAGTCA GATGCCTATG ACTTCATAAG CTAGTAGCTT TTGCAAACTT
GCAATAACTT TTTATTTGGG ATATGTACAG TAGTAACTTA TGTATGAGCA TCACATAGAA TGTACGGAGA AGCAGGATAT
AGGCATTTAT AAATAACAAT AAGTTCTCTT TAGCCTTTCT GGTTTGGACA TTATATCAAA CAATCACACT GTACTTGTTT
ACTGTGAGAC ACCATGTTCA ATTGCTCATG TTATGTTATT TCCAGCCCTG CCCATATTAT GCCTTTGCTT GAAATTGTCC
GGACGGAGAA GACATCACCG CAAGCTATTC TTGATCTCAT CACAGTTGGG AAAATGATAA AGAAAGTCCC TGTTGTGGTT
GGGAACTGCA CAGGCTTCGC AGTCAATCGT ACATTTTTCC CTTACACACA GGGTTCTCAT CTTCTAGTTA GTATTGGGAT
CGACGTTTTC AGAATTGATC GAGTAATAAG CAGCTTTGGC ATGCCAATGG GACCTTTTCA GTAAGTGTTC AACTCTATTT
TTATACATCT TTATGTCGCA CTAGATTATC ATCACAAATA TTAGTATTTG TATTGAAATT TGTTTAAATA GACAAAATAA
GATAGGAAAT ATGTAGTTTG AATAAATTCA TGGTTTGCGT TTTATGCCTT ATTTATTTGT ATATAGCTTA TAGTGAACAT
TTTTTTAGTC CAATTCAATT TATTTTTGTG GGCTTTAGTA AGCTACATCT TTTGAAATGT GATTGGATGC CTCCTCAATA
ACTCAATGGA GGTCACATTT CCTTTAATTG TTGTAATGCA ACATGTCACT TATACCTTTG TGCATAAATA TCTAATCACC
TCAAATTGCA TACCTTCTGT GCATGAACAA TTAACAGTGA GATATTGTTG TGTGCCTTAC CTAGATTATT TAAATGAACA
GTGCAGTGCT GGTCCGTTGT TGATTGACCT GTTTTTCTGT AATCATCATT CCCAAGGGTT TTTATATCTA ATAAATCCCC
CTCTTCCCTC TGCACTCCTG CAGACTGCAA GATCTGGCTG GATATGGAGT GGCATTGGCA GTAAAGGATA TCTATGCGGC
TGCCTTTGGA ACAAGGAATC TGGACTCTAA TCTGGTGGAT TTGATGGTAC AGAATGGACG GCAGGGTATG CTTCCTAGCC
TGCTTTTGCT CCTGCGATGC TGTTGGTTGT AGCAGATAGG ATGGATTGGA CAAGAAACAG TAGTCAAACA AAAAATTGAT
GTGAAATTTC CCTGTATTTT ATAGGAAAGA GCAATGGTAA AGGTTATTAC CTTTATGAGA AGGGTGGGAA GCCGAAGCCT
GACCCAAGTG TTCAGGTTGT GATTGACGAG TACAGAAGAT GTGCAAAGAC AATGCCTGGT GGAAAGGTTT CCCTCCTTCC
CTGCCTGAGT CATGGATTTT TCATTTAAAA ATTCCCATGC TATCCCAGCT GGTGATGGAA AAAATTTCTG ACATGGAGAC
ATTATCTTGC TTGCAGCCTG TTACTTTATC TGATCAAGAT ATATTGGAGA TGATTTTCTT CCCAGTTGTT AATGAGGCAT
GCAGGGTCAT GGATGAAAAT GTTGTGATCC GAGCTTCTGA TCTTGATATT GCTTCTATCC TTGGGATGGG TTTTCCCAAG
TTCAGGTAAA CAACTGTTGC TTAAGCTTAA GTTGTGTGGT ATGTTATTAG CAGGTGACAA TTTACGTTCA CTTGCATAAT
CGTCTTATGT AACTAAATGC TAATAATTAG CATGCACTTG AAGTATGCCT TAGTTGTATC AATATTTAGA TACTTGGATT
GAGATGCATG TTTGGTTTGT GCACAAATAT AACATATGGA CTTAAAATTT TATCAGAACA CTTCTGATAT CTAAACATGA
ACCTTATTTA ATCCTTATGT AGGGTAGGGC TGCATGGCGT ATATATCAAA ATAAATTTAT GTTGCTTTAT AACGTGGTGT
TTAACTTTAG CACTTGGAAT TCCACCATAA GGTATTCCAA ATGAGTGTTT ATTGCTAAGT TCTGTTACAT CATTGTCTAA
TACCAAACAA CTCTCAAGTT TTATATTATT ATGCATTCGT GTGAAGCTGT ATAATTTTGT CAATCCATGA TACTGTTAGC
CGTCAGTCCT CACATGTATA TTTTGCTTTC CTTTTTCTTT TTGTCGCGCA TAAAGTGTTG TGGTTATTCT GAGTGTTAGT
TTAACCTTTG ATGTTTTTTA TGAAGGGGTG GTCTTGTCTT TTGGGCTGAC ACTATTGGAG CACCTTATAT ACATTCAAAG
CTTAGCAAGT GGACTGAAAT TTATGGCGAT TTCTTCAAAC CATCATCCTA TTTGGAAGAT AGAGCTAAAA GAAGCCTACC
ATTGGTACTC TCTCTCTTCC TCTCTCACTC ACACACAAAG ACACAACGCA GTCTGTTTCT GATGGATAGT ACCCGATCCT
TGCCTTCCTA ATTTTAGTAT ATGTTGAGTA TAGCGGTTGC AATTATGAAT TAGTATGCTA TAGGCAAATA TTATAGATCT
GCATGTGTAT CGAGTGCATA TGATTATTAC AAACATTTGA GTAGTTTGAT GTTCTCACTA GAAAGTATAA ATAATCCTAT
TAGTACATGC AACGAACGAA GCCTCTGTGT CAGCACTGAC CGCCTTGGTT CAAAATTGGT TACATGGTGG GACGACCATG
GGCCCTGATC ATACAGTTCG ATTTTGATAT TATTACTGCA CCTGCTCATA CGCTCATTCA TTGTGCTTCT CGCTTTAGTG
TTCTGTGATG CTCTATCAGC TTGTTCGATA ATTAATCATG TTACAATCTC TGCAGAGCGC ACCAAACGCA ACCCAGCAGG
CTTCGTCGAG GTCACGCATG TGAGATGCTA TTTCAGCTGA TGGCAGAATA ATTGCTTGAT GTGCATCGGC ACCCTAGTTG
ACCCTCATAT CTGGGACCTG AAAAAGGAGG TCAGAGCAGT GTTCACCATG TAATCTCTTT TGGATATTTT GGCCTTTCCG
GTTTTCCGAA CTGGGTTGCT ATGGCAATCG GAGTAATAAA TGTTGGCTTC GGATGCCACA AAACTGTAAC TTTATGGCCG
ATAGCCTTTT ACTCCAGTGT TACATTAAAA TGTATATGGT ACAGTGTTTT TTTAACTTGT AGTAAAAT

Locus: Os02g0274100

Loading...

Locus: Os02g0274100

Loading...