Os02t0278700-01

Locus

Os02g0278700

Description

Ent-copalyl diphosphate synthase 1, Gibberellin (phytohormone) biosynthesis

RAP-DB Gene Symbol Synonym(s)

OsCPS1, OsCPS1ent

RAP-DB Gene Name Synonym(s)

ent-copalyl diphosphate synthase 1

CGSNL Gene Symbol

CPS1

CGSNL Gene Name

ENT-COPALYL DIPHOSPHATE SYNTHASE 1

Oryzabase Gene Symbol Synonym(s)

OsCPS1, OsCPS1ent, OsCPS, Os CPS1, OsTPS4

Oryzabase Gene Name Synonym(s)

rice ent-copalyl diphosphate (CDP) synthase1, ent-copalyl diphosphate synthase 1, "Ent-copalyl diphosphate synthase 1, chloroplastic", Ent-CDP synthase 1, terpene synthase 4

Transcript Evidence

AK100333

Protein Evidence

Q6ET36

Literature

PMID: 18256497

PMID: 15542489

Note

Manual Curation

February 3, 2021

Gene Ontology (GO)

Molecular Function: magnesium ion binding (GO:0000287)

Molecular Function: terpene synthase activity (GO:0010333)

Molecular Function: lyase activity (GO:0016829)

Functional domain (InterPro)

Terpene synthase, N-terminal domain superfamily (IPR036965)

Terpenoid cyclases/protein prenyltransferase alpha-alpha toroid (IPR008930)

Isoprenoid synthase domain superfamily (IPR008949)

Terpene synthase, N-terminal domain (IPR001906)

Terpene synthase, metal-binding domain (IPR005630)

Full-length cDNA

J023080N01 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0278700-01)

RiceXPro (AK100333)

Others

Oryzabase (3127)

KEGG (Os02t0278700-01 (EC:5.5.1.13))

Transcript

2942 bp

>Os02t0278700-01 Ent-copalyl diphosphate synthase 1, Gibberellin (phytohormone) biosynthesis
GCTCTCGCCTCCCGCATCGCATCTCCATCATCTCCCCATCCTCCTCTCTACTCGTGTCTT
CCATTCCTCCATCCCTCGCGCGCATCTCCGACGAGCTCTCTACTCCCTCCTCCGCCGCCG
ACGATGATTCACCTCCACTCCCCGCCGACGGCGCCCGCCGCATTCGGCGGCGCCGGCTCG
GCGGACTGGCGGCGGCGGCGGCGGTGGTCATGGTCGTCGTCGTCCCGCGCTCCGGTGGCT
AAAGGTGGCCATCTTCGTCCGTGCGTTTGGCGGCGCGGCGGCGACGACGGCGGCGGCGAG
GATCATCACGCCGACGGCGGCGGCGGCGGCGGAGGAGGAGCGGCGTGGAGGGCGCGGGCC
ACCACCGCCGGCGTGTCGAGCTCCAGCAGTACAGCCAAAGGGCTGCAAGCCAACATCATC
GAACATGAGACCCCCCGGATCACGAAATGGCCCAATGAATCACGCGACCTCGACGATCAC
CAACAAAACAACGAGGCTGATGAGGAGGCAGATGATGAGCTGCAGCCACTGGTCGAGCAG
GTGAGGTCGATGCTGTCGTCCATGGAGGACGGCGCGATCACCGCGTCGGCGTACGACACG
GCGTGGGTGGCGCTGGTGCCGCGGCTGGACGGCGAGGGCGGCACGCAGTTCCCGGCCGCC
GTGCGGTGGATCGTCGGCAGCCAGCTCGCCGACGGGTCGTGGGGCGACGAGGCGCTCTTC
TCCGCCTACGACCGCGTCATCAACACCCTCGCCTGCGTCGTCGCCCTCACCAGATGGTCC
CTCCACCATGACCAGTGCAAGCAAGGGCTTCAGTTTCTGAATCTGAACTTGTGGAGGTTA
GCAGAGGAGGAGCCGGATACGATGCCGATTGGGTTTGAGATTGCATTCCCTTCTCTTGTG
GAGGCAGCTAGGGGTTTGGGTATTGATTTCCCATATGATCACCCTGCTCTCAAGGGCATT
TATGCAAACAGAGAACTCAAGCTTAAGAGGATTCCAAAGGACATGATGCATATAGTCCCA
ACTTCAATTCTGCATAGCCTTGAAGGGATGCCTGGGCTGGATTGGCAGAGGCTTCTGAAG
CTCCAATGCAGTGATGGATCCTTCTTGTTCTCCCCTTCAGCTACTGCTTATGCTCTCATG
CAGACCGGTGACAAGAAATGCTTCGCGTACATCGACAGGATCATTAAGAAATTCGACGGA
GGCGTTCCGAACGTTTACCCGGTCGATCTTTTTGAGCACATATGGGTTGTCGATCGGTTG
GAGCGTCTTGGGATATCGCGGTACTTCCAACGAGAGATTGAACAGAACATGGACTATGTC
AACAGGCACTGGACTGAAGATGGGATTTGCTGGGCTAGGAACTCCAATGTAAAAGAAGTG
GATGACACCGCTATGGCTTTCCGTCTACTACGCCTCCATGGATACAATGTATCACCAAGT
GTGTTCAAGAATTTTGAGAAGGATGGGGAGTTCTTCTGTTTTGTGGGGCAATCAACTCAA
GCAGTCACTGGGATGTATAACCTGAACAGAGCATCTCAGATAAGTTTTCCAGGAGAAGAC
ATTTTGCAGCGTGCAAGGAATTTCTCATATGAGTTCCTTAGAGAAAGAGAAGCCCAGGGG
ACACTTCATGATAAATGGATCATCTCCAAGGACCTACCAGGAGAGGTACAATACACACTA
GATTTTCCTTGGTATGCGAGCTTGCCACGCGTCGAGGCAAGAACATACATAGGTCAATAT
GGTGGAAATGATGACGTCTGGATTGGAAAGACACTCTACAGGATGCCAATTGTGAATAAC
GCTACATATCTCGAGTTGGCGAAACAGGATTTCAACCGTTGTCAAGCTCTACATCAGCAT
GAGTTGCAGGGTCTACAAAAGTGGTTCATTGAGAATGGCCTGGAAGCTTTTGGGATGACA
CCTGAAGATGTTTTGAGAGCTTATTTTTTGGCTGCCGCGTGCATTTTCGAACCAAACCGT
GCCTCTGAGCGACTTGCATGGGCTAGAGTGTCAGTGCTGGCCAACACTATTTCTAGGCAT
TTTTACAGCGATATGTCAAGCATGAAAAGGATGGAGCGTTTCATGTGGAGCAGCCTCTAT
GAAGAAAATGGCAATGTTTTGGGGCTAGAAGGATATGCAAAAGATGGAATCCTTGCGAGG
ACACTTTGTCAACTTATAGATTTGTTGTCTCAAGAGACACCGCCAGTTCGAGAAGGTCAA
AAGTGTATTCATAATCTCATAAGATGTGCTTGGATTGAATGGATGATGCAACAAATCAAT
ATGAAGGATGGCAGATATGACAAAGGCAGAGTTATGCATCCAGGGTCATGCACTGTTCAT
AATAAAGAAACATGTTTACTTATTGCTCAAATTGTTGAAATTTGTGCTGGACGAATTGAG
GAGGCAGCATCTATGATAAATAACACCGAAGGTTCTTGGTTTATTCAACTTGCTTCCTCT
ATTTGCGATTCTCTTCATGCCAAGATGTTACTTTCACAGGATACCAAGAAAAATGAGACA
ACAATAAATCAAATTGACAAGGAAATTGAGTTGGGTATGCAAGAACTTGCTCAATATCTT
CTTCCAAGAGTTGATGATAGAAGAATTAACAACAAAACCAAGCAGACCTTCTTGAGCATT
GTGAAAAGCTGTTACTATGCTGCCAATTGCTCACCACATATGCTTGACCAACACATTTCT
GAAGTGATTTTTGAGCAAGTTATTTGAAATAAAGTTTAGGCAAATAGAGCATTTGTCAGA
TTGAATCGCATGTAAATATTTCTGTGCAGAAAAAATATGTAAAGAATGAGAGAGAACAAG
CATATAAACAATAGTATTATTGTTGAAAGCTAACAATTTTTACATCAAGTGAATGATGTA
TCTCTGTATGGTTCTACATGTGGGACACATtttctataaattatttattttgggtttgtt
ct

CDS

2604 bp

>Os02t0278700-01 Ent-copalyl diphosphate synthase 1, Gibberellin (phytohormone) biosynthesis
ATGATTCACCTCCACTCCCCGCCGACGGCGCCCGCCGCATTCGGCGGCGCCGGCTCGGCG
GACTGGCGGCGGCGGCGGCGGTGGTCATGGTCGTCGTCGTCCCGCGCTCCGGTGGCTAAA
GGTGGCCATCTTCGTCCGTGCGTTTGGCGGCGCGGCGGCGACGACGGCGGCGGCGAGGAT
CATCACGCCGACGGCGGCGGCGGCGGCGGAGGAGGAGCGGCGTGGAGGGCGCGGGCCACC
ACCGCCGGCGTGTCGAGCTCCAGCAGTACAGCCAAAGGGCTGCAAGCCAACATCATCGAA
CATGAGACCCCCCGGATCACGAAATGGCCCAATGAATCACGCGACCTCGACGATCACCAA
CAAAACAACGAGGCTGATGAGGAGGCAGATGATGAGCTGCAGCCACTGGTCGAGCAGGTG
AGGTCGATGCTGTCGTCCATGGAGGACGGCGCGATCACCGCGTCGGCGTACGACACGGCG
TGGGTGGCGCTGGTGCCGCGGCTGGACGGCGAGGGCGGCACGCAGTTCCCGGCCGCCGTG
CGGTGGATCGTCGGCAGCCAGCTCGCCGACGGGTCGTGGGGCGACGAGGCGCTCTTCTCC
GCCTACGACCGCGTCATCAACACCCTCGCCTGCGTCGTCGCCCTCACCAGATGGTCCCTC
CACCATGACCAGTGCAAGCAAGGGCTTCAGTTTCTGAATCTGAACTTGTGGAGGTTAGCA
GAGGAGGAGCCGGATACGATGCCGATTGGGTTTGAGATTGCATTCCCTTCTCTTGTGGAG
GCAGCTAGGGGTTTGGGTATTGATTTCCCATATGATCACCCTGCTCTCAAGGGCATTTAT
GCAAACAGAGAACTCAAGCTTAAGAGGATTCCAAAGGACATGATGCATATAGTCCCAACT
TCAATTCTGCATAGCCTTGAAGGGATGCCTGGGCTGGATTGGCAGAGGCTTCTGAAGCTC
CAATGCAGTGATGGATCCTTCTTGTTCTCCCCTTCAGCTACTGCTTATGCTCTCATGCAG
ACCGGTGACAAGAAATGCTTCGCGTACATCGACAGGATCATTAAGAAATTCGACGGAGGC
GTTCCGAACGTTTACCCGGTCGATCTTTTTGAGCACATATGGGTTGTCGATCGGTTGGAG
CGTCTTGGGATATCGCGGTACTTCCAACGAGAGATTGAACAGAACATGGACTATGTCAAC
AGGCACTGGACTGAAGATGGGATTTGCTGGGCTAGGAACTCCAATGTAAAAGAAGTGGAT
GACACCGCTATGGCTTTCCGTCTACTACGCCTCCATGGATACAATGTATCACCAAGTGTG
TTCAAGAATTTTGAGAAGGATGGGGAGTTCTTCTGTTTTGTGGGGCAATCAACTCAAGCA
GTCACTGGGATGTATAACCTGAACAGAGCATCTCAGATAAGTTTTCCAGGAGAAGACATT
TTGCAGCGTGCAAGGAATTTCTCATATGAGTTCCTTAGAGAAAGAGAAGCCCAGGGGACA
CTTCATGATAAATGGATCATCTCCAAGGACCTACCAGGAGAGGTACAATACACACTAGAT
TTTCCTTGGTATGCGAGCTTGCCACGCGTCGAGGCAAGAACATACATAGGTCAATATGGT
GGAAATGATGACGTCTGGATTGGAAAGACACTCTACAGGATGCCAATTGTGAATAACGCT
ACATATCTCGAGTTGGCGAAACAGGATTTCAACCGTTGTCAAGCTCTACATCAGCATGAG
TTGCAGGGTCTACAAAAGTGGTTCATTGAGAATGGCCTGGAAGCTTTTGGGATGACACCT
GAAGATGTTTTGAGAGCTTATTTTTTGGCTGCCGCGTGCATTTTCGAACCAAACCGTGCC
TCTGAGCGACTTGCATGGGCTAGAGTGTCAGTGCTGGCCAACACTATTTCTAGGCATTTT
TACAGCGATATGTCAAGCATGAAAAGGATGGAGCGTTTCATGTGGAGCAGCCTCTATGAA
GAAAATGGCAATGTTTTGGGGCTAGAAGGATATGCAAAAGATGGAATCCTTGCGAGGACA
CTTTGTCAACTTATAGATTTGTTGTCTCAAGAGACACCGCCAGTTCGAGAAGGTCAAAAG
TGTATTCATAATCTCATAAGATGTGCTTGGATTGAATGGATGATGCAACAAATCAATATG
AAGGATGGCAGATATGACAAAGGCAGAGTTATGCATCCAGGGTCATGCACTGTTCATAAT
AAAGAAACATGTTTACTTATTGCTCAAATTGTTGAAATTTGTGCTGGACGAATTGAGGAG
GCAGCATCTATGATAAATAACACCGAAGGTTCTTGGTTTATTCAACTTGCTTCCTCTATT
TGCGATTCTCTTCATGCCAAGATGTTACTTTCACAGGATACCAAGAAAAATGAGACAACA
ATAAATCAAATTGACAAGGAAATTGAGTTGGGTATGCAAGAACTTGCTCAATATCTTCTT
CCAAGAGTTGATGATAGAAGAATTAACAACAAAACCAAGCAGACCTTCTTGAGCATTGTG
AAAAGCTGTTACTATGCTGCCAATTGCTCACCACATATGCTTGACCAACACATTTCTGAA
GTGATTTTTGAGCAAGTTATTTGA

Protein

868 aa

>Os02t0278700-01 Ent-copalyl diphosphate synthase 1, Gibberellin (phytohormone) biosynthesis
MIHLHSPPTAPAAFGGAGSADWRRRRRWSWSSSSRAPVAKGGHLRPCVWRRGGDDGGGED
HHADGGGGGGGGAAWRARATTAGVSSSSSTAKGLQANIIEHETPRITKWPNESRDLDDHQ
QNNEADEEADDELQPLVEQVRSMLSSMEDGAITASAYDTAWVALVPRLDGEGGTQFPAAV
RWIVGSQLADGSWGDEALFSAYDRVINTLACVVALTRWSLHHDQCKQGLQFLNLNLWRLA
EEEPDTMPIGFEIAFPSLVEAARGLGIDFPYDHPALKGIYANRELKLKRIPKDMMHIVPT
SILHSLEGMPGLDWQRLLKLQCSDGSFLFSPSATAYALMQTGDKKCFAYIDRIIKKFDGG
VPNVYPVDLFEHIWVVDRLERLGISRYFQREIEQNMDYVNRHWTEDGICWARNSNVKEVD
DTAMAFRLLRLHGYNVSPSVFKNFEKDGEFFCFVGQSTQAVTGMYNLNRASQISFPGEDI
LQRARNFSYEFLREREAQGTLHDKWIISKDLPGEVQYTLDFPWYASLPRVEARTYIGQYG
GNDDVWIGKTLYRMPIVNNATYLELAKQDFNRCQALHQHELQGLQKWFIENGLEAFGMTP
EDVLRAYFLAAACIFEPNRASERLAWARVSVLANTISRHFYSDMSSMKRMERFMWSSLYE
ENGNVLGLEGYAKDGILARTLCQLIDLLSQETPPVREGQKCIHNLIRCAWIEWMMQQINM
KDGRYDKGRVMHPGSCTVHNKETCLLIAQIVEICAGRIEEAASMINNTEGSWFIQLASSI
CDSLHAKMLLSQDTKKNETTINQIDKEIELGMQELAQYLLPRVDDRRINNKTKQTFLSIV
KSCYYAANCSPHMLDQHISEVIFEQVI*

5'UTR

chr02:10283605..10283727 (- strand) : 123 bp

CDS

chr02:10283484..10283604 (- strand) : 121 bp

chr02:10283234..10283389 (- strand) : 156 bp

chr02:10279057..10279151 (- strand) : 95 bp

chr02:10278641..10278950 (- strand) : 310 bp

chr02:10277944..10278127 (- strand) : 184 bp

chr02:10277543..10277757 (- strand) : 215 bp

chr02:10277304..10277424 (- strand) : 121 bp

chr02:10277066..10277178 (- strand) : 113 bp

chr02:10276715..10276941 (- strand) : 227 bp

chr02:10276468..10276583 (- strand) : 116 bp

chr02:10276261..10276359 (- strand) : 99 bp

chr02:10275911..10276153 (- strand) : 243 bp

chr02:10275105..10275231 (- strand) : 127 bp

chr02:10274777..10275025 (- strand) : 249 bp

chr02:10273934..10274161 (- strand) : 228 bp

3'UTR

chr02:10273719..10273933 (- strand) : 215 bp

FASTA

>Os02t0278700-01 class=Sequence position=chr02:10273719..10283727 (- strand)
GCTCTCGCCT CCCGCATCGC ATCTCCATCA TCTCCCCATC CTCCTCTCTA CTCGTGTCTT CCATTCCTCC ATCCCTCGCG
CGCATCTCCG ACGAGCTCTC TACTCCCTCC TCCGCCGCCG ACGATGATTC ACCTCCACTC CCCGCCGACG GCGCCCGCCG
CATTCGGCGG CGCCGGCTCG GCGGACTGGC GGCGGCGGCG GCGGTGGTCA TGGTCGTCGT CGTCCCGCGC TCCGGTGGCT
AAAGGTGGTT GTGCATTTCG ATATATCTTG GCCGGTCTAT ACGTTTCTTC AGTCGATCGG TCGATCTCTT TAATTACTTA
CGTCGTCTCT CTGTGCAGGT GGCCATCTTC GTCCGTGCGT TTGGCGGCGC GGCGGCGACG ACGGCGGCGG CGAGGATCAT
CACGCCGACG GCGGCGGCGG CGGCGGAGGA GGAGCGGCGT GGAGGGCGCG GGCCACCACC GCCGGCGTGT CGAGCTCCAG
CAGTACAGCC AAAGGTAGTA TACGGGCTCA TGAGAGATCT TTCTTCCGCC GCTTTTGGTC TTGTCGTTTT CCGGGTCGTC
GACGAGGGTG AGTCAGTGAG TGCACTGCAT GCTTTATTCA CTGCACTCCT GCACCTGCAT AGCCTAGTGA GCAGCTGCCT
TTGGTTGTGC CAACGCTTTA GTTTCGTTCA GAGATCACTT TAGGTACATA GATGATCTAC ACTGTGTGGG GGGAGGAAGA
GACTCCTTCA AAGATCATTG ATGTGGTCGC TGAACATATG AACCCGATCG AAGAACAGTA GGATCTATAT ATGTCGGCGA
TTACGTTCCT CTGACTTTAC GATAGTCGAA GGATTCTGAT CAACTGCGTT GTGACGCTGG GTTATGTGAT GAGGGTAAAA
AGTAGTTTTG TTTTTTTGGT TTGTGGACTT TGGGTTCATG CATAGTCACT GAACAGAGGA GGACAGAGAT AGATTTAGTT
TGGATGGAGG TTCTCGGGAG AGAATATATA AAGTGGGTAG AATTTTTTGA GAAGTTACTT TGAGGATATA AAGCTAGTTG
ATTTTTCGTT GGCGGATTTA CTTTTTCTAT AGAAAAAGTA TTACCTCTTA TAGTAAGGTA AATTAGTGGC TCGGGACACA
CAGCTTGAGA TTATGTCGGT GCTTAAAATG ACGTGAGTTT TTATCTGTAG CGATTGATTG ACACTTCTGA ATTATTAGGC
ATGCCATGAA GTACAATCAA GTTCACCACC GCCTCTTACC TATGTAAACA GTTACCTTAT TGTGTAAAAA AAAAACTGGA
AATAATTATT TTATTTTTGT GAAACATTGT ACACGCGGGC ACTCATATAA ATGCACATAC ACACATACCC TACTCATATG
ACCACCTCCA AACACTGAAC TAAtactccc tccggttcta tattaattga cgttttggac aaggttgagg ctaaactttt
ataactttga ccatcaataa ctttaaaaat atttagttta aagaaactag aaaaacatat atagatttgt ctttcaaaac
actataataa aagtaaacat gcatttattt attgtatata ttataataga aaaataaggt caaaggtata tcttatagag
cgtgttattg ttcaaagcat caattaaaat gaaaccggag ggagtaTAAT ATATCTTGAA ATTTATGGAG ACAGAAGAGA
AGCCTCGCTG TCAGCATATC TTGAAAATAA TTATTTGTAA ACAGTTACCA TCTTTTAAAG TATTATCGTT GGGGTGCAAT
AATTTTTTTA ATAAAATTTG CAGAAAAAAA AACCTTGGTT TGATTTGTAT AACAACACAA TAATCTTTTG TGTGAAATTC
ACTTAAATCT CTACTATTAT AAAAATTGAA CCATGGTTTG ATTTGTATAA CACCACAACA ATCTTGCATT GTGTGATATT
CACTTAAAAG AACCATGGTT TTACTTATAT ctctactatt ataaaaattg atgatgtttt taccagtatt ttggtacgtc
attcgtgtat gaattgattt tttaagtttg ttcgtttttg gaaatataga tctgtagttg agttgggttt taagtttgtt
cgtctttgga catacaaaag gagttgtata agaaatataa aacttgcatg ctaacttgag atgatgggac ttctaattgc
agctcatgat tttctagaaa aatatatatc caagcgaatt ttcaaagtaa atttcacctt aactaaacca tataacaata
aaaagattaa aataggtttc acccgttgca atgcacagac ttttttctag gaaTAGTGAT AAATCAAATT GGACGAAAAC
TGAACGGCAG TTTGTCTCCG AAATTCAGTT TTTGGAAGTT AATCTCCAAT CACGTCCATA AACGCATAAA TGCTGAAGAC
AAATTAATAT GATATATAAA CAGAACCAAC AAGATAAAAA AGAACAAATC AATTGCCTAT TCTGCAACTA GTTAGTGTTG
TCGTCGCTCT TGCAGTCCAT TCAGTGTTGT GTGGATTCAA ATATATCGTA CGATGTCGCA ATCAATTGGC ATATATCGCA
TTTATCTTTC CAGCAGCTGT CAAATTAATA AAGCTGTTCA CTGCGAGTTA GACTGTTCAT TATTCGTTGT TTCTACCAGA
ATCCAGCATC ATTATTCGTT GTTACTATCA CAACTGTTGA TCGGTTGAAT TTTACAAAAA AATCTCAATG CAAGATTGTT
TGTATCTATC CAATTTTTTT TATTGATGTA CGGGTTTGTT CTGGGGGACC TTGTTCTCTT TGTAAGGCAT GCTTTGCTTT
AGCCAAATGG CCAGCATATC AATTTGGTTA TCGAATAAAA TTGGCCCAAG ATTCGATCGA TTGGGCTTGG ACTGGGACTT
GACGTTGTGT GTCGCGTAGA TTTGCCACAT CAGACTAGCA CTGCAGATAC AGGATTAGAT TTAGGGGTCA GTTTCATGAA
TCCTAAGATT TTTCAACTGA GAATAAATGT TAAGAGATTA TAGCAAAAGA AATGCATGGT TGAATATAAT ATTTATTCCC
ATCGATCCTA GTCAATAAAA TTATATATGT TGCCCTTGAT ACTTGGGCTA GCTCTCGTGA ATCTCCAATG CCTTTAGGTT
TCATATTTTG AATTGCCCTA TAGTTTCACG TATTATATAG GATGACTTAT TAGTTTGTGA AGAAGTACAA GTATAATTTA
GTTGGGCTCC ACAATATTTT TTTATAATGC AAATTAATGt actcccccat cctaaaatat aaggcacaac catcactaaa
aaaaaccaag aaaaaaatta attacgtact cagttgaatc acctcgatgc atacaactaa tgtgattggg ggtttgatgg
tagaggagtt aaaacaaagc gaaattagag gaagatgtgc tagttaatgt atatatgcca tgaacttttt gtgccttata
ttTTTTAGAT GGTGGACAAG GTGTATTTGA CATTGGGATA CGCTGATCAA GTGAAAATAC AAAAATAGGT TGTCTAGTTT
TCAGTCTCCG GAATGCTGAA AGGTGAGAAA AACGGCATCT CATCATTTAA GAGAGACAAA AGTTTAATGT GATAGTAACA
TCTATTTTTT GACGTGCTTT TAGTAACATC TTAATAAAAG TTGTATTCTT CCTCATCTAA TAGTAGTAAA CGGTAGAGCT
TTTTTGGCTA GTTGCTTAAA AATGGGAAAT ACTTTTGGAA CATCATCAAA ACTTTCTCAA ACTTTAAATG CTGTGAGCCT
CGTGCGCAGT TACAACGATC AATAGAGGCA GCTCACAGAA GCTTAATTAC AGAGAAGTGA AGCTTAATTA GGATACATAT
CTTAATTAAG ATACTCCTAC ATCCTTCGAG TATACAGTTG ACATTGAAAC TTACTCCCAT CTGTTCCCAT Attccctaat
aaatcaaaac ggtttattag aaacaaaaat taatctatag gtaaaacttt tatatattta ttcttagcga taatctacgt
tgaaaatatc ttaaaatcaa ctttaaactt aaattttaaa ttttaaattt taaattttga cttttgcctt ggtttattag
gccaaccgat gaggccatta tatgttctct caattgagag gttcaaactg cATATAAGCT TCAGTTCTAT GTATACTCCA
AAATCCAAAC TGTGATTTGG ATCCTGCCAG AGCAACAGGC CAACTGCATT GGATTCTCTT TTCTGCCCAC TGAGAATGTC
GTTGTCTCGT ATTTTTGTTA CAGATAATCC CAAAATGGTC CAGAAGCTTC CGAAAAATAG TATCTCTTAG ATTTTTAGGG
CTTGTTCAGT TTGATTTGCA ATGTCAAATT CTGGTAAGAC AACAAACTAA ATGAGACTTT ACCATCACAC GACCTTATCA
ATCCTTACCA ACATTTGGTA ATTCTAAAAA CTTCTACTCA CAAAACTATA CCAAAAACAT GCGGCACATA CGTACGCCAT
ATACAAGCGA TACTCAACAC TTTGCTCATG AAATCATGCT GTTTTCTTTT TTTTCTTTTG GCATTTATAA ATGGAAATGC
TGTAATCCAT GTGCAGGGCT GCAAGCCAAC ATCATCGAAC ATGAGACCCC CCGGATCACG AAATGGCCCA ATGAATCACG
CGACCTCGAC GATCACCAAC AAAACAACGA GGTGAATCAT CCACTACCTT CTTACAGTAA TCATTCATGG TCACATTCTT
CTCGTACGTA ATCTCATTAA GCACATTTTG ATTAATTAAT TAATTTGTTT ACGTCAGGCT GATGAGGAGG CAGATGATGA
GCTGCAGCCA CTGGTCGAGC AGGTGAGGTC GATGCTGTCG TCCATGGAGG ACGGCGCGAT CACCGCGTCG GCGTACGACA
CGGCGTGGGT GGCGCTGGTG CCGCGGCTGG ACGGCGAGGG CGGCACGCAG TTCCCGGCCG CCGTGCGGTG GATCGTCGGC
AGCCAGCTCG CCGACGGGTC GTGGGGCGAC GAGGCGCTCT TCTCCGCCTA CGACCGCGTC ATCAACACCC TCGCCTGCGT
CGTCGCCCTC ACCAGATGGT CCCTCCACCA TGACCAGTGC AAGCAAGGTA TCATCAGTAA TAATTCATTT ATCACAGATT
AGTGAAGTTC AGTTAATTAC AGTCTTTGTG TTACAGTTTC AGATAGGTTT GTTACAGTTA ACTTTTCAGA TAGATTGTTA
ATGCAGTCTG TGAGATAGAC AGTTTGAGAT AGGTTTGTTA CAGTTATTTT TTCAGATAGA TTGTTTTCTA GATAAAGGAT
TTATATAAAA CCCGGCTTTT ACATCCCAAA GAAAGTACAC AGCCAACCTT TTCAGATAGA TTGTTAATGC AGTCTGTGAG
ATAGACTGTT ATTTAATAAC AATCCTTTTA CAGTTTCAGA TAGATTGTTG GTTACTCCCT CGGTCTAata catctagatt
cgtagtacta gattgtgttt aatccggtag tgctaagttg ctataattta agacggaggg agtaATTAAT TTGAAGGTGA
TGATTAGTTA GTTCCAGATT GCAAGTGAGG CAATGTGTGA GATGATGTTG ATGTTTTCTG AATTTTTTGC TCTTGTTCAG
GGCTTCAGTT TCTGAATCTG AACTTGTGGA GGTTAGCAGA GGAGGAGCCG GATACGATGC CGATTGGGTT TGAGATTGCA
TTCCCTTCTC TTGTGGAGGC AGCTAGGGGT TTGGGTATTG ATTTCCCATA TGATCACCCT GCTCTCAAGG GCATTTATGC
AAACAGAGAA CTCAAGCTTA AGAGGTATAA ATCCATACGC GTCGTATGTA TAATATCGTG ACCGCTGTCG TGCATCTGTA
GTTGGTGCAG AGATCGGAAG TTACTTTCAT TATCTTACAA AAGATATGTA TATAGTGGCA AACATTGGAG AGCTTAACTA
GTTAAAACTT GATGACGCTT GTCTTTTGTT GACAAAAACT CACAATGTAG GATTCCAAAG GACATGATGC ATATAGTCCC
AACTTCAATT CTGCATAGCC TTGAAGGGAT GCCTGGGCTG GATTGGCAGA GGCTTCTGAA GCTCCAATGC AGTGATGGAT
CCTTCTTGTT CTCCCCTTCA GCTACTGCTT ATGCTCTCAT GCAGACCGGT GACAAGAAAT GCTTCGCGTA CATCGACAGG
ATCATTAAGA AATTCGACGG AGGCGGTAAA AGATTCGTGG CATTTCACTG ACCAATGTTT CGGAAATCTG GTTTGCTACA
GTGCACTAGG TGCCATTTTG TGGCAGCTGA TCTCAGATCA TGTGATGTTG AAAATTTTTT CAGTTCCGAA CGTTTACCCG
GTCGATCTTT TTGAGCACAT ATGGGTTGTC GATCGGTTGG AGCGTCTTGG GATATCGCGG TACTTCCAAC GAGAGATTGA
ACAGAACATG GACTATGTCA ACAGGTTTTT CATAATGTTT TGTTTTATTA GCGCAATTAT TTTCTCAAAC TGATATGTGT
GGTGTCTTCT GTAGTTACTT TAGGAACCTT ATGAGCAGAG TTTTTTAACC TGTGTTTCTC ACTGTGTAGG CACTGGACTG
AAGATGGGAT TTGCTGGGCT AGGAACTCCA ATGTAAAAGA AGTGGATGAC ACCGCTATGG CTTTCCGTCT ACTACGCCTC
CATGGATACA ATGTATCACC AAGTATGGAG CTGTTTTTCT TCTTTCAAAT TCAGATGAAA TCACATATCC TGGGAAAAAC
TGTATCGTGT TACGCTTCAA GATCATATTA CCTTTTCTGA ATCACAAATT GCTATTGTAA ATTCAGGTGT GTTCAAGAAT
TTTGAGAAGG ATGGGGAGTT CTTCTGTTTT GTGGGGCAAT CAACTCAAGC AGTCACTGGG ATGTATAACC TGAACAGAGC
ATCTCAGATA AGTTTTCCAG GAGAAGACAT TTTGCAGCGT GCAAGGAATT TCTCATATGA GTTCCTTAGA GAAAGAGAAG
CCCAGGGGAC ACTTCATGAT AAATGGATCA TCTCCAAGGA CCTACCAGGA GAGGTATAAT CTAGTTACTT TTGATTGTAG
CATAATTTCT TTATAAACTT CATAGTACAT TATTTTAAAT TTGTTCTCTT TGCAAATATT TACCAGTTCC TGAGTACTGA
TATAACATTG CACTGAATCA ATAGGTACAA TACACACTAG ATTTTCCTTG GTATGCGAGC TTGCCACGCG TCGAGGCAAG
AACATACATA GGTCAATATG GTGGAAATGA TGACGTCTGG ATTGGAAAGA CACTCTACAG GTTAAAGTTT TCACAACTTT
GTTCCAACTT CAAACATTGT TCAATATGAT TATCTTCAAA ATAATTGAAG TTAAGATTTG CTGATAATTG TTGGGTGCCT
TTTGTCAGGA TGCCAATTGT GAATAACGCT ACATATCTCG AGTTGGCGAA ACAGGATTTC AACCGTTGTC AAGCTCTACA
TCAGCATGAG TTGCAGGGTC TACAAAAGTA AATCAACTCC ATAAACTTCA TTTCTGTTTC ACCACACATT TTCCTCTGTG
AACTTATCTT AAACAAAGAT AAAATTTGTT TTGGCACCAC AAATATATAT TTAGGTGGTT CATTGAGAAT GGCCTGGAAG
CTTTTGGGAT GACACCTGAA GATGTTTTGA GAGCTTATTT TTTGGCTGCC GCGTGCATTT TCGAACCAAA CCGTGCCTCT
GAGCGACTTG CATGGGCTAG AGTGTCAGTG CTGGCCAACA CTATTTCTAG GCATTTTTAC AGCGATATGT CAAGCATGAA
AAGGATGGAG CGTTTCATGT GGAGCAGCCT CTATGAAGAA AATGGCAATG TTTTGGGGTG AGTACTGCGA AACTGAAATT
CCTTGAAATT ATGATTTTGC ACCGTGCAGC ATGATGATGG GTTTTTTTAT GGATAGTTAC TACTAATTGC TTCTGATGCT
TGTCCTCTCT ATGAGAAAAA TGGGAAGCTG AATTGAATGG TAAATGGTTT CTATTTTGAC AATCAAAAGA ATGAATATAT
TAGGTTTTTT TATTTGAAGG GAGCACAAAT TGTCCTTCAG CTCTTAAAAT AAGAGGAAAA CTAATGTTTT TCACCTGGAA
AACAGTAAAG GAAGGTAAGT ACGTAAAAGC ATTAAAATGG AATGTTGAAA GTTACAACCA TTTAAGAGGG ACTAGTTTTT
ACaacatttg gtaaatatat aggtttaaaa aaaacatttg gtaaatataa attagatcat gaactcattt cttgagaatt
atttggaaga acaatttgtg atcataggat tattacaaaA TGACAGAAGA ATATTCCAAA CTTGGTATTT GTTCTATCCA
GCCTAATATA ATGCTTATAT TTTTTTTATA TAATAAAAGA GAAGAATGCT TGCCTTGGAG TACACCACAT ATTACAATGT
AGCGATGTAT CTAGAAAATT CTTATCATAA TGCCATAAAA TGTAAAAAAA TCTACTAAGA TTTTTCTCAG TATTTAACTT
AAAATTGTTC GTTCAGGCTA GAAGGATATG CAAAAGATGG AATCCTTGCG AGGACACTTT GTCAACTTAT AGATTTGTTG
TCTCAAGAGA CACCGCCAGT TCGAGAAGGT CAAAAGTGTA TTCATAATCT CATAAGATGT GCTGTAAGTA AAACATAACT
ATAAACTTCT TATTACAGTG TTGTAGCCAG AAAAATGCTA AGATCTTTGT TTGCATTTCT AGTGGATTGA ATGGATGATG
CAACAAATCA ATATGAAGGA TGGCAGATAT GACAAAGGCA GAGTTATGCA TCCAGGGTCA TGCACTGTTC ATAATAAAGA
AACATGTTTA CTTATTGCTC AAATTGTTGA AATTTGTGCT GGACGAATTG AGGAGGCAGC ATCTATGATA AATAACACCG
AAGGTTCTTG GTTTATTCAA CTTGCTTCCT CTATTTGCGA TTCTCTTCAT GCCAAGATGT TACTTTCACA GGTAACTCTT
ATACATTACA TAGTCTGTTG ACTAGAGTTT TATTCTGATA CTAGTGTAAT TTTGCAGTAG TTATATAAAT TAAAGAATGG
TGTAGGTTGT TTTTTGTTTG ATCAAATTAT GTGTATAGTG GTTAGAAAGT TTATTGTAAA ACTTTATATG TTAGTATAGT
TTCATCGATA AAAACTTCTC ACCGACTTGA CAAGCTGTAT TCACTGAATT GGGCACGTTA TAATCACTTG GATGATGAAA
AACTAATTAT AAAAATGAAA TCAGCATTTG TAATAAATAG TTTTATATAT TCTCCAGTAT AGATGTTGTA ACATGATAAC
AAGTCGGTAC TTTGGTCCTG AACAATGCAC TTTCAGTATA AATATATGAA ATTCTTACAA TCCTTGGGGG TTATTGCAAT
GTAGATGTAC CTCCTAGGTA CCACTACGAA TAGGTGTCAA GAGGTAAAAA ATAAGTAACA GTACAAAAGA TAATTCTAAC
TCTCAAGGCA TCTCCAAGGA CTGAAGTTTT TTTTTTTAGC AGTTACATCA GAGCTATGGT TCTATTTACT ATATTTGCTT
CAATGTCAAT GTATTCAGCT ACTCAACTGT TGATACAATT TTGTAGGATA CCAAGAAAAA TGAGACAACA ATAAATCAAA
TTGACAAGGA AATTGAGTTG GGTATGCAAG AACTTGCTCA ATATCTTCTT CCAAGAGTTG ATGATAGAAG AATTAACAAC
AAAACCAAGC AGACCTTCTT GAGCATTGTG AAAAGCTGTT ACTATGCTGC CAATTGCTCA CCACATATGC TTGACCAACA
CATTTCTGAA GTGATTTTTG AGCAAGTTAT TTGAAATAAA GTTTAGGCAA ATAGAGCATT TGTCAGATTG AATCGCATGT
AAATATTTCT GTGCAGAAAA AATATGTAAA GAATGAGAGA GAACAAGCAT ATAAACAATA GTATTATTGT TGAAAGCTAA
CAATTTTTAC ATCAAGTGAA TGATGTATCT CTGTATGGTT CTACATGTGG GACACATttt ctataaatta tttattttgg
gtttgttct

Locus: Os02g0278700

Loading...

Locus: Os02g0278700

Loading...