Os02t0290300-01

Locus

Os02g0290300

Description

WD40/YVTN repeat-like domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsWD40-40

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK068360 (DDBJ, Best hit)

Protein Evidence

XP_002892199.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

WD40 repeat (IPR001680)

WD40 repeat-like-containing domain (IPR011046)

WD40/YVTN repeat-like-containing domain (IPR015943)

WD40-repeat-containing domain (IPR017986)

WD40 repeat, conserved site (IPR019775)

WD40 repeat, subgroup (IPR019781)

WD40 repeat 2 (IPR019782)

Full-length cDNA

J013146O19 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0290300-01)

RiceXPro (AK068360)

Others

Oryzabase (10721)

KEGG (Os02t0290300-01)

Transcript

2842 bp

>Os02t0290300-01 WD40/YVTN repeat-like domain containing protein.
TTCCAGGCATCCCCTCGTCGTGGTGCATATATATATTGAAGGCCTGAAATGGCTGAACAT
TGGGCAGAAGGTTCAAAGCATGCTTCTGCACAAGCATCGTATTCTAGATATCAAGCAACA
TCTGCAAGATCTAGGCAAAGGAACATCTTCGATCTATTAGCTCAGCGAGAGATTTCCCCT
CGAACAAAACACCAAGCTAAAAAACTTTGGAGCAAATCTCCAGGAAATGATGCTGATTCC
AATGAACTAAGATATGCAGCTACAGATGCTAAACATGATATATATTCATGGGCAGAATCA
CAGTCCCTGCATCACTGGTCTGCCAAATATTGTCCTCTTTTGCCACCCCCCAGGTCTACT
ATCGCAGCTGCATTCAGCCCAGATGGGAAAACACTTGCATCTACACATGGTGATCATACT
GTTAAAATAATTGACTATCAAACTGGGAAATGTTTGAAAGTGCTGAGTGGACATCGGCGC
ACGCCTTGGGTGGTTAGATACCATCCATTACTTCCTGATATCCTTGCTAGCGGTAGTTTG
GATCAGGAAGTCCGTCTTTGGGACGCTAAAACCTCAGACTGTATTGGATCTCAGGACTTC
CATCGGCCAATTGCATCAATAGCATTTCATGCAAGGGGGGAGATTCTGGCAGTTGCATCA
GGTCACAAACTGTACATATGGAACTACAATAAAAGAGATGAGGCTGCTGCTCCAACCATT
ATATTAAGAACCCGCCGCTCACTAAGAGCTGTCCATTTTCACCCCCATGGTGCTCCATAT
CTTCTTACTGCAGAGGTTAATAATCTTGATTCTGCGGACTCACCATTGACCCTTGCAACC
TCTTCGGGCTATTCAAACTATCCCTCGGCTGTGTTTTTTGCAAATATTAATTCCAGAAAC
TGTCCACATCATGAGGCTAATTCATCATCACCTTGCTTGCTTTGGCCTGCATACCTCAGG
GATGATGGAAGTTTATGTCTGATTCGCAATGACTTGGTTAGTAGTTCAACCAATGTGCAT
CAGAGACCATCATCTTTAGCTCAAAATCCATTGGCATCAGATGTTGAAAATCAACAGCCT
GACCAACTTGTCACGCCTATGGATGTGTGCCCTGGAGAACCATCTACTTCTCATGCTTCT
GCATCTGGTTTAAGTGGAGTTGAAATGCAGATTGACAGGGGGCAACCTAGCTCCAGATTA
CTGGGCAGTAGCTCCACTAGTAATCATGAGAGTTCTACTGCTAGAGATGATGTGCAAATG
CCCTCCCTGAGCAACAGCGTGCCGATTCCAGCAACATCTCAGCCTTCAGAACATGATGGC
CGTCATGGTATGCCAATGAATTCGTTTACCACTTCTAGTGGATTAGATGTTCACATGATC
CTAAGAAATTCAGAGGGTGGAAATCATCATCATGATCTCTTCAGTGACTCGCGTAGCTGG
GAGCTTCCCTTTTTGCAGGGCTGGTTCATGGCCCAAAATCATACAGGTGCTTCTCCATCT
ATTCCGATTGATGTCGGCAGTTCTAGAGGATCAAATCGACATCATGCTTCTCGTCGTCAT
GTTGTGGGCTCATTACGTGGGGTTGGGAGTTCACTTCTAGGCCCCCAAATTGATGAAGCT
GAGGTTCATGCTGCATCATTAGGTGTTGGATCTGAACTTACTACCTCACTGCTTGCTGCT
GGAGCTGCTGAATTACCTTGCACAGTGAAGCTTAGAATATGGCGGCATGATATCAAGGAT
CCATGTGTTACATTGGAACCCGAGGCATGCCGGTTGACAATTTCTCATGCCGTTCTCTGC
AGTGAAATGGGTGCCCATTTTTCCCCTTGTGGACGATTTCTGGTAGCATGTGTTGCCTGT
TTGCTGCCTCAAACTGAAGGCGACCGTGGTAGCCAATTGCCTGTGCAGTATGATTCTGCA
GGGGCCGGAACATCACCAACTCGTCACCCTCTCCCTTCTCACCGAGTTATTTATGAGCTC
CGAGTTTACTCTCTTGAGGAGGCAACGTTTGGCAAAGTTCTTACATCAAGAGCGATAAGG
GCAGCTCATTGCTTAACTTCCATCCAGTTCTCACCCACTTCAGAGCACATACTATTGGCA
TATGGTCGTCGTCATAACTCTATGCTTAGGAGCATTGTGATGGATGGGGAAACTGGAATT
CCTGTATATACTATCTTGGAGGTCTATAGAGTATCGGACATGGAGCTGGTAAGAGTTCTT
CCTAGTGCTGAAGATGAAGTAAACGTTGCATGCTTTCATCCTTCCCCTGGAGGTGGTCTT
GTTTATGGGACCAAGGAAGGAAAGCTCAGGATCTTGCAGCACAATGGTGCAGATATCACA
AGCACAGGGTTGAATTGCTTTATCGAGGAAAATATGCTTGAGATTCAGAGATATGCGCTG
GAAGGCTGAACGATTGGTTGCCATGTGTTATGTGTACTTCTCCAGGAATTTTCCTCTGCA
AAGTTTATCATTGTACAAGTGAGCCTCAAGGAAATCATCAGATTTCAGCAAAGTCATGGC
AGATTCTCAAATGAGTTTGCTAGAGTGCCTTGGGGATAGGTCTGTGCAGAGGGAGTTGGA
AGATGTAAATCAACACAACCATGTTGCTGCTGTCAAGTCATCACGATGCTGTAATTACAG
AATTGTACATGTAATCTTTAATCAACTTAACTTGTATTTTAGAAAGCACACAATGCTAAC
CCTTTTCTTTTCAATGGCAGAGGTATTTATTGTTCCCCTTGTATTTTTCGTTGTGTAGTC
TTTTATTCCTTGACGGGGTACCAAATGCCAATGATTAAAGTAACTAATCATCAATTCATC
TTTGGTTCAAAGATGTACTCTG

CDS

2361 bp

>Os02t0290300-01 WD40/YVTN repeat-like domain containing protein.
ATGGCTGAACATTGGGCAGAAGGTTCAAAGCATGCTTCTGCACAAGCATCGTATTCTAGA
TATCAAGCAACATCTGCAAGATCTAGGCAAAGGAACATCTTCGATCTATTAGCTCAGCGA
GAGATTTCCCCTCGAACAAAACACCAAGCTAAAAAACTTTGGAGCAAATCTCCAGGAAAT
GATGCTGATTCCAATGAACTAAGATATGCAGCTACAGATGCTAAACATGATATATATTCA
TGGGCAGAATCACAGTCCCTGCATCACTGGTCTGCCAAATATTGTCCTCTTTTGCCACCC
CCCAGGTCTACTATCGCAGCTGCATTCAGCCCAGATGGGAAAACACTTGCATCTACACAT
GGTGATCATACTGTTAAAATAATTGACTATCAAACTGGGAAATGTTTGAAAGTGCTGAGT
GGACATCGGCGCACGCCTTGGGTGGTTAGATACCATCCATTACTTCCTGATATCCTTGCT
AGCGGTAGTTTGGATCAGGAAGTCCGTCTTTGGGACGCTAAAACCTCAGACTGTATTGGA
TCTCAGGACTTCCATCGGCCAATTGCATCAATAGCATTTCATGCAAGGGGGGAGATTCTG
GCAGTTGCATCAGGTCACAAACTGTACATATGGAACTACAATAAAAGAGATGAGGCTGCT
GCTCCAACCATTATATTAAGAACCCGCCGCTCACTAAGAGCTGTCCATTTTCACCCCCAT
GGTGCTCCATATCTTCTTACTGCAGAGGTTAATAATCTTGATTCTGCGGACTCACCATTG
ACCCTTGCAACCTCTTCGGGCTATTCAAACTATCCCTCGGCTGTGTTTTTTGCAAATATT
AATTCCAGAAACTGTCCACATCATGAGGCTAATTCATCATCACCTTGCTTGCTTTGGCCT
GCATACCTCAGGGATGATGGAAGTTTATGTCTGATTCGCAATGACTTGGTTAGTAGTTCA
ACCAATGTGCATCAGAGACCATCATCTTTAGCTCAAAATCCATTGGCATCAGATGTTGAA
AATCAACAGCCTGACCAACTTGTCACGCCTATGGATGTGTGCCCTGGAGAACCATCTACT
TCTCATGCTTCTGCATCTGGTTTAAGTGGAGTTGAAATGCAGATTGACAGGGGGCAACCT
AGCTCCAGATTACTGGGCAGTAGCTCCACTAGTAATCATGAGAGTTCTACTGCTAGAGAT
GATGTGCAAATGCCCTCCCTGAGCAACAGCGTGCCGATTCCAGCAACATCTCAGCCTTCA
GAACATGATGGCCGTCATGGTATGCCAATGAATTCGTTTACCACTTCTAGTGGATTAGAT
GTTCACATGATCCTAAGAAATTCAGAGGGTGGAAATCATCATCATGATCTCTTCAGTGAC
TCGCGTAGCTGGGAGCTTCCCTTTTTGCAGGGCTGGTTCATGGCCCAAAATCATACAGGT
GCTTCTCCATCTATTCCGATTGATGTCGGCAGTTCTAGAGGATCAAATCGACATCATGCT
TCTCGTCGTCATGTTGTGGGCTCATTACGTGGGGTTGGGAGTTCACTTCTAGGCCCCCAA
ATTGATGAAGCTGAGGTTCATGCTGCATCATTAGGTGTTGGATCTGAACTTACTACCTCA
CTGCTTGCTGCTGGAGCTGCTGAATTACCTTGCACAGTGAAGCTTAGAATATGGCGGCAT
GATATCAAGGATCCATGTGTTACATTGGAACCCGAGGCATGCCGGTTGACAATTTCTCAT
GCCGTTCTCTGCAGTGAAATGGGTGCCCATTTTTCCCCTTGTGGACGATTTCTGGTAGCA
TGTGTTGCCTGTTTGCTGCCTCAAACTGAAGGCGACCGTGGTAGCCAATTGCCTGTGCAG
TATGATTCTGCAGGGGCCGGAACATCACCAACTCGTCACCCTCTCCCTTCTCACCGAGTT
ATTTATGAGCTCCGAGTTTACTCTCTTGAGGAGGCAACGTTTGGCAAAGTTCTTACATCA
AGAGCGATAAGGGCAGCTCATTGCTTAACTTCCATCCAGTTCTCACCCACTTCAGAGCAC
ATACTATTGGCATATGGTCGTCGTCATAACTCTATGCTTAGGAGCATTGTGATGGATGGG
GAAACTGGAATTCCTGTATATACTATCTTGGAGGTCTATAGAGTATCGGACATGGAGCTG
GTAAGAGTTCTTCCTAGTGCTGAAGATGAAGTAAACGTTGCATGCTTTCATCCTTCCCCT
GGAGGTGGTCTTGTTTATGGGACCAAGGAAGGAAAGCTCAGGATCTTGCAGCACAATGGT
GCAGATATCACAAGCACAGGGTTGAATTGCTTTATCGAGGAAAATATGCTTGAGATTCAG
AGATATGCGCTGGAAGGCTGA

Protein

787 aa

>Os02t0290300-01 WD40/YVTN repeat-like domain containing protein.
MAEHWAEGSKHASAQASYSRYQATSARSRQRNIFDLLAQREISPRTKHQAKKLWSKSPGN
DADSNELRYAATDAKHDIYSWAESQSLHHWSAKYCPLLPPPRSTIAAAFSPDGKTLASTH
GDHTVKIIDYQTGKCLKVLSGHRRTPWVVRYHPLLPDILASGSLDQEVRLWDAKTSDCIG
SQDFHRPIASIAFHARGEILAVASGHKLYIWNYNKRDEAAAPTIILRTRRSLRAVHFHPH
GAPYLLTAEVNNLDSADSPLTLATSSGYSNYPSAVFFANINSRNCPHHEANSSSPCLLWP
AYLRDDGSLCLIRNDLVSSSTNVHQRPSSLAQNPLASDVENQQPDQLVTPMDVCPGEPST
SHASASGLSGVEMQIDRGQPSSRLLGSSSTSNHESSTARDDVQMPSLSNSVPIPATSQPS
EHDGRHGMPMNSFTTSSGLDVHMILRNSEGGNHHHDLFSDSRSWELPFLQGWFMAQNHTG
ASPSIPIDVGSSRGSNRHHASRRHVVGSLRGVGSSLLGPQIDEAEVHAASLGVGSELTTS
LLAAGAAELPCTVKLRIWRHDIKDPCVTLEPEACRLTISHAVLCSEMGAHFSPCGRFLVA
CVACLLPQTEGDRGSQLPVQYDSAGAGTSPTRHPLPSHRVIYELRVYSLEEATFGKVLTS
RAIRAAHCLTSIQFSPTSEHILLAYGRRHNSMLRSIVMDGETGIPVYTILEVYRVSDMEL
VRVLPSAEDEVNVACFHPSPGGGLVYGTKEGKLRILQHNGADITSTGLNCFIEENMLEIQ
RYALEG*

5'UTR

chr02:10986624..10986645 (- strand) : 22 bp

chr02:10983579..10983604 (- strand) : 26 bp

CDS

chr02:10983487..10983578 (- strand) : 92 bp

chr02:10982517..10982666 (- strand) : 150 bp

chr02:10982169..10982285 (- strand) : 117 bp

chr02:10982012..10982096 (- strand) : 85 bp

chr02:10981244..10981352 (- strand) : 109 bp

chr02:10981083..10981150 (- strand) : 68 bp

chr02:10980851..10980976 (- strand) : 126 bp

chr02:10979934..10980624 (- strand) : 691 bp

chr02:10979511..10979826 (- strand) : 316 bp

chr02:10978851..10979054 (- strand) : 204 bp

chr02:10978687..10978747 (- strand) : 61 bp

chr02:10978298..10978411 (- strand) : 114 bp

chr02:10977773..10977886 (- strand) : 114 bp

chr02:10977606..10977692 (- strand) : 87 bp

chr02:10975043..10975069 (- strand) : 27 bp

3'UTR

chr02:10975007..10975042 (- strand) : 36 bp

chr02:10974672..10974785 (- strand) : 114 bp

chr02:10972770..10973052 (- strand) : 283 bp

FASTA

>Os02t0290300-01 class=Sequence position=chr02:10972770..10986645 (- strand)
TTCCAGGCAT CCCCTCGTCG TGGTAAGCCC TAGCTTCTGA TTGTTTGGTT CCGCCGCGTG TGCCCCGCTG AGAAATGGAA
TACTTGTTTT GGGATCCCGT GCGATTCGTT GTCGGAGTGC GCTGTTGGAT TGGATTAGAT TGGATTGGTC CCCCGGATTT
GTTCGATGCT AGGATGCAAT CCGTCCGTAG GGTTCGTGGC AGATATGTTC TGTTTTGGGC GTGCGGAGGG TTCCTGAATT
TCCTATGATC CTAGCCTCCT AGATGCATCC GCCAGCCCCA AGCGGACAAG CTCGAGGTAG AAGGCGAGGC GAGATCGGGT
TACATGGTGA TTGGGTTCTT GTGGAGCTGT TTTGACTTGT AAGCTGGGTA TTTTTGGCAT GTTGGCAGTT GGCATATGAT
GTTAACTAAC TGTAGGGGTT TGATCTTGGT GGTTCGCCGC TAGACTCTTT CACCCCTATA GGAATCTATA CGGTAGTTTT
TTGGTGTGTG GCAATGCATC TAACTTTTTT GTTTTCATCG GTCTGGTTGT TTTAGCATAT TGTATTACTG TATCAATTTT
CCTTTCATGT GCATATCAGA TATGAACCAT ATTGGTAGTC TTAGGGGCTC TTTGGTTGCC TGGATCTACC CTGGCTCGCA
TGGGAGATGC AGACGCGTCC GCTTGTTTGG TTAACTGCAT GCCCTTTGGA GCCTGGCTGA GTTCATGCAA AAGTAGGTTA
GCCAGGCCCG AGAGAAACGG CCGATTTCTT CTTCGCTCCT CAGCCTGGCT CACTCGATGC AAGGTGGATG CAGCGCGGGT
GCAAGCGTTG CATCAGTGCG TGCACGTGCG TGGCAGGGGT CTAGCATCCG CTCACCTCCT CCCTCTCATT TTCATCTTCC
CATTCTCAAT TGCTCTCCTC TTCCCCTCTC TCCCTTGCCG CTGCCGCCAC CAAATCCCCT GCGGTCACCG CTCGTTTGGC
GTCTTCTCCG GTGGTGGACT GGCAGCTGAC CTCGAGCTCC CTCGGCCGAC CCCAGTGGAG AAGCTACTGC CGCTATTACA
TCCCTTGCCA TCTCCATCGC GTCGATGCGC TGCCTCTCTT TTCTGTCGCC ACAACTGCCT TCTCCGACCG CCAGGCCACC
AGATCCGGTG ACCATGGTGG CGTTGAGCAG CTGGGAGCGC CGATGAAGCA AGTCAACGAT GAGATTGAGG GTTTTTTTTT
TTGTTTTCTC TGTTCTATTT TCTACTGAGA GAAGAGCAGA GGAGCGCGCA TGTCAGATCA GGATGAGAGG CCAGCGAGGA
GCATGGTACT GGCCGGCGAC AGAGGAGCTG GGAACGGCTG GCGGCGATGA GGCAAGAACT CATCTCCTCG ACAACAAGGA
GGAGGACAAA CGCTTCTCTC TCTTTTTTTT TCTTTTTTTT TTCCAGCGCT TTGCTATCAA ATGGTGGAGG AAGTTTTGTT
GACTTTTTAT TTTTTGAGAA CTCAAGAAAT TTCACTTTTG GTGCAGAGAA TGCCGGGTGA TTTTTGATGC CAATATTATT
CTTTGTATGT GAAAAATTGT TTATACCTAT TGTCTAGATT TGAAATTTTT GTAggtaacc tcacccaact aaatgaagag
gtaactagac tcaaatctat ccaaccaacc aaacaaaatc ttttccaaac cgcatctctc atgcactcaa ccaaacaaaA
TCTCATCCCA ACCGGGCTAA ACTGATGCAA ACAACCAAAC AGTTGCATGT GTATCTCTTC ATCCAGGCTA GACTCAACCA
GGATGAGAGA GATGAGCCAG GCTAGGAAAA TGCAAGCAAC CAAACACACC CTTAATGATT CATTGCTGAG CTGTTGATCT
ATCCTTGCTT TATGCATTTT TGGCATAGGA TGTGAGCTCA GAATGTAGGC CTTCCTTGGA CTGACTTGCT CTCCATGTTT
TTACCAATGA ATAAATTGTA CTTGTCCAAA AGTAAGAATT GAAATTCTTT TTGTTTGCAT TGTTCCCATG CATTCTTAAC
TCACAAGAGC AGGACATCAA ATGTGTTATG AAATCTGTTG GCAATGGCAA GCATCCCTGA AACACACAAC ATATGCAGAA
TAAACTTAAA GAGCAAGTGT TTGATGACAA GTTTTCAAAT TTTTCAATGA AAAACCCATC TTAATGAATA TGCACACTGC
TGTACAAGCC TGTTTGCAAA ATTTACACTT AATATGCTAG GTCCATAATT GCCTACAGCT CAAAGCACAA AAAGATGTGA
TCCATCCCTG AAATATCATG TGCAGAGAGT ATTTCCAACG AGTGCACAGT TCACCAAAAT AAAATCTAAT GAGATGAAAC
CTTAGCTCTT TTAACCTACT AGAAATAACT AAACCGTTGA ATATATATAG CATGCCATGT CACTTTTATT TTTATCAAAA
TTGGCAATAT TATGTCATAA ATATGATTTT CTTACTATCT AGCAGACTCA CTAAAACTTG GTAGTTTGAA GCAACCGTTT
CTAGTTGGGC TTGGTTTTAT ATTCTAAGCA GTCTTTTGAT GAGAAATGTT CTTTGGTGCC TTAGCGCCTG GCTGCTAGTA
GAGCATGACT TGCATAGTGC ACCGTGCTTT GGATAATTTG AGATGCATTT TCTTTGCTGC ATCTCGCTAT TGTGCATGTG
TGCACCTTGT TTGCCTTTGG CAGCACTGCT GCTGGAGCTG GATGTTCTGT AGTACAATTT TGTGAATATC TCAAACAGAA
GAACATTGTG CGAGGTGACC TAAGGTCAAA TGATAATCTA AGCATCTGTG GCAAGTTATA TCTACCACAC ACTGGTTACC
ATAGGGAATC TATCAAATGG TAGGTTGTTC GTGTCCAGTC ACTCTTGATG TGCTGTTTTC TAATTTTTAA TTGGAGTATA
CTGCATTTTC TGATTTTCAT ATGTTGGATT TTGGGATGTT TGTGTCAGTG TTTTTCTGAA GAATTGTTCT AAAAACTTCT
TACTTAACTT CTGTTATATA TCATACAATT TCATTAACAT TTTACATCTT GTTGTATCTG GTTGGTTCAA TTAATTTTTA
GGTGCATATA TATATTGAAG GCCTGAAATG GCTGAACATT GGGCAGAAGG TTCAAAGCAT GCTTCTGCAC AAGCATCGTA
TTCTAGATAT CAAGCAACAT CTGCAAGATC TAGGCAAAGG TAATTGTCTA CTTAACATCA TCATTTAGTT TTCTGCTAGA
GAAGTTGGTA CAATCCTATG AGAAACTAAC TGTTACAATT CAATTGATAA AATGTATTCT TTCTTTTGAT TCTGTGTTTG
GAACCAATAT TGCATCCATG TGCAATATTT GACACAGTAA AGGTGGAATT ATATCTGCAA ACCCTCTTGT GACTTATTAA
GTTTGATTAG CACCCTGGCC TTATTTATCT TCTTCTACTC TTGGTACAGT ATTTGTTAGC ATACAAAGCC CTTTTAAAAC
AACATTTGTG AAAAGAACCT CACATATTTG TTCCAGAAAA TGGACCAAAG CTATGGGAAT ATATTCTGCA TACTGTTACA
CCACTTCACC TAGAGGTCAG CTGTGTTGGA TTAAGTGTCG TCTCCACTGG TAGAAATGTC AAAAGGTCAA TACCACATGA
ATTAGCATTA GTATTTTGAT AATGTTATGG CCTATTGGAC TATAACATTA GCATTATGCC TAACCAATTT CAGGGTAACA
TTCATCTTGA ATGTAATTTG CAAAAGCTCC TTTGACCAAC ACATTGTTGT TATCATAATA CTTAAGTACT GCGGGAATAG
CTTAATGGCA AATGCAACTC CCTGATAGAG TAGCACCATC AGTGTTAATG CCACCATTGA GCCATTGTGG TATCCCCATG
GCCCCCTCCA AAAATAAACT GCATGAGGGG TCATCTTCTG GATAATATAA AAACATTTTC AGTAACCTGT TTTCTAATGG
CATTATAATA TGAGATCACT TGTTAAATAT ATAACCTTTG GTTTGCCCAT TATTGTCAGG AACATCTTCG ATCTATTAGC
TCAGCGAGAG ATTTCCCCTC GAACAAAACA CCAAGCTAAA AAACTTTGGA GCAAATCTCC AGGAAATGAT GCTGATTCCA
ATGAACTAAG ATATGCAGCT ACAGATGCTA AACATGATAT ATATTCATGG TACGGGGTCT TACTTTACCA GGATGGTTTA
AGCACAATTT GTCATGTCTG TAGTAATGAT TGAGTTACAT ATATTGTACT TTCGATTTTA CACCTAATAT TTCTTTGGTA
AATATTTATA AACCCTATGA ACTATTCTTC ATTGTCTATT TTAACTGTTG AGTTACATAG TTTTGTACTC TCACTCTTAT
ACCTAACTTT TCCCTGGAAT GAAACCTTTT CTGTATACAG GGCAGAATCA CAGTCCCTGC ATCACTGGTC TGCCAAATAT
TGTCCTCTTT TGCCACCCCC CAGGTCTACT ATCGCAGCTG CATTCAGCCC AGATGGGAAA ACACTTGCAT CTACACAGTA
AGTTTATTAT TTGCGGAATA TAAGGATTAA AGTGAAGGCA TGTGGACTAA CTCCATCTCT TTTGAGCAGT GGTGATCATA
CTGTTAAAAT AATTGACTAT CAAACTGGGA AATGTTTGAA AGTGCTGAGT GGACATCGGC GCACGCCTTG GGTGGTATGA
TTATGAACAC TGTCATCATG TTCCAGAATG TGTGCTACAA GCTCTTATAG ATAAAGGATA AATCTTACCC TGTCCCTGCT
ACAAGTCACT GCTTTTGTTA CCTACCTTCC TACAAGTAAT TTTGGTTTAT TGGCACCCTC AAAGTCGTTT CAGTCTGTAA
TAACCCTGTC CCTCACTGTT GCCTGTAATT TCACGATTCA CTTGACCAAT TTGTTGGGGG ATATTTCATC AAATCGTCAC
AATCAGCTGT TCTGCTATCA TCATGTGTTG CACGCCACAT GGGTCCTACT AATTTACCAT TACCACCCGT AGCGCAATAA
GGGGAAGATA GATTGGGGGG TTGGGGGGCA CTGTTGTAGG GGATATAGTT GCACTTTTGG ATGGTACAAT GATTTACAGG
GGGTGCTGAT AAACCAAAAT GACTTGGGGT TAAGTCACAA TGACCTTTAA ATAAACAACT CAAGTACTGA TATTTTTACT
AACCATCAGG CCTTATATCA GCATGTCATG TTTGTACCCA TATCCTTATC CACCACTTGG CAGCTTAGTC CATAGGGAGC
ATTTTATATA TGTTTTACAT AAAAATGCAT AAATGCTGTT TTTGCAGTCT TATTTGCCAC TTATTATTTT GAGTTTCTTC
TGTTCTATTT CAGGTTAGAT ACCATCCATT ACTTCCTGAT ATCCTTGCTA GCGGTAGTTT GGATCAGGAA GTCCGTCTTT
GGGACGCTAA AACCTCAGAC TGTATTGGAT CTCAGGACTT CCGTAATATA TCTAAGCAGA TCCTAATGAG TATGTCTCCT
TCCATGGGTG AAATCTGAAT ACTAACCTTT TCAGTGATGT TCTCTTATTT GATAGATCGG CCAATTGCAT CAATAGCATT
TCATGCAAGG GGGGAGATTC TGGCAGTTGC ATCAGGTCAC AAAGTGAGAT TATAGTGTTA AATTTGAAAA AAAAAGGAAG
TCTTTCTGTG CTTGTTTTAT GAACAATGAT CAAATAACAT ATAGTGCTCA ATGCAATGTA TTGTGCCAGC TGTACATATG
GAACTACAAT AAAAGAGATG AGGCTGCTGC TCCAACCATT ATATTAAGAA CCCGCCGCTC ACTAAGAGCT GTCCATTTTC
ACCCCCATGG TGCTCCATAT CTTCTTACTG CAGAGGTAGA AATAATATAC TCCCTCAGTC CCAAAATATA Acaacttctc
tacctacatt ctcttctcaa ccaatcacaa ccttcccaca tttaattcca cctgctttct taatacccat gtccaaccct
aaaactcatt ctgggacgga ggtagtaCTG TTTTCTGCAT TTTTTGCTTT CTTTGCATAA TTTCATGTAC CGATTGATCT
TATGCAGATA TTCAATTTCA GGTTAATAAT CTTGATTCTG CGGACTCACC ATTGACCCTT GCAACCTCTT CGGGCTATTC
AAACTATCCC TCGGCTGTGT TTTTTGCAAA TATTAATTCC AGAAACTGTC CACATCATGA GGCTAATTCA TCATCACCTT
GCTTGCTTTG GCCTGCATAC CTCAGGGATG ATGGAAGTTT ATGTCTGATT CGCAATGACT TGGTTAGTAG TTCAACCAAT
GTGCATCAGA GACCATCATC TTTAGCTCAA AATCCATTGG CATCAGATGT TGAAAATCAA CAGCCTGACC AACTTGTCAC
GCCTATGGAT GTGTGCCCTG GAGAACCATC TACTTCTCAT GCTTCTGCAT CTGGTTTAAG TGGAGTTGAA ATGCAGATTG
ACAGGGGGCA ACCTAGCTCC AGATTACTGG GCAGTAGCTC CACTAGTAAT CATGAGAGTT CTACTGCTAG AGATGATGTG
CAAATGCCCT CCCTGAGCAA CAGCGTGCCG ATTCCAGCAA CATCTCAGCC TTCAGAACAT GATGGCCGTC ATGGTATGCC
AATGAATTCG TTTACCACTT CTAGTGGATT AGATGTTCAC ATGATCCTAA GAAATTCAGA GGGTGGAAAT CATCATCATG
ATCTCTTCAG TGACTCGCGT AGCTGGGAGC TTCCCTTTTT GCAGGGCTGG TTCATGGCCC AAAATCATAC AGGTTTGCAC
CCTGCACCTT CCAAATGATG ATGCCTTTGT ACTGGAGGCC TACCTTCTTG TGGTACTGGC ACTGCTGAGA CTGATTAAAC
TGTGTAATTG AACTTGCAGG TGCTTCTCCA TCTATTCCGA TTGATGTCGG CAGTTCTAGA GGATCAAATC GACATCATGC
TTCTCGTCGT CATGTTGTGG GCTCATTACG TGGGGTTGGG AGTTCACTTC TAGGCCCCCA AATTGATGAA GCTGAGGTTC
ATGCTGCATC ATTAGGTGTT GGATCTGAAC TTACTACCTC ACTGCTTGCT GCTGGAGCTG CTGAATTACC TTGCACAGTG
AAGCTTAGAA TATGGCGGCA TGATATCAAG GATCCATGTG TTACATTGGA ACCCGAGGCA TGCCGGTTGA CAATTTCTCA
TGCCGTTCTC TGCAGGTGCT TCATTGTACT TTTGGTTTTC TTGTATTCAC ATTTTTCCTG CACAACACAA ACTTTTATTT
CCTTTCTGTT GTTTCCTGTA TTGCTTTGCC TGAATATGTA CATAAGTGGA TAAGTTATGG TGTGCAGCAA CAACAAAAAC
TTACTGTTCT GTTTCACAAT GTTTGTCCAT TAAGAAAACC AAGAATGTGG TTATTACAAT GTTTTCACTC ATTAAATGCT
TTGAAATGGG TAAAATGGTT GCATTTTGCT ATGCATGTTT TTTTCTCGTT AAATTTTTCT TAGATTTTGT ACTTCCTTGG
TTTGAGCGCA TGGGGTGCTG TGGAAAAACA TTGTTAGACG GAGGGAGTAT CTTTTAGATG TTTGACATGA AGTGCGTATT
TTATTTTTGA CAAACTGTGC AGTGGATTGT TGACCCTTCT TTGCTTACTC TAAAGTTAAT AATTATTGCA GTGAAATGGG
TGCCCATTTT TCCCCTTGTG GACGATTTCT GGTAGCATGT GTTGCCTGTT TGCTGCCTCA AACTGAAGGC GACCGTGGTA
GCCAATTGCC TGTGCAGTAT GATTCTGCAG GGGCCGGAAC ATCACCAACT CGTCACCCTC TCCCTTCTCA CCGAGTTATT
TATGAGCTCC GAGTTTACTC TCTTGAGGAG GCAACGTAAT TTTCTCAACA GTCTTGTTAC ATAGTATGCT CTTTTGCTAG
GTTTCTCATT TGTAAACGTT CTAGTTATTT TGAAATTGTG AATGTATTTT CCTTACAGGT TTGGCAAAGT TCTTACATCA
AGAGCGATAA GGGCAGCTCA TTGCTTAACT TCCATCCAGG TTAACATCTC ATTTGTTTGT GTGTTTGTTG GTTTTTTAGT
GCTGCAAAAG ATAAGCAGGC ATCTCTGCTG CCACCCTTCT ACTGGGAGCA GAAACATATT ATATACCTCA GATAATTGCT
GTCGAACTTG TGGCTTGTGT CTCAAGCATT GTCCAGTAGC AGCATTATAA AGTTGACTGG CTTTTGCATT TTTGACCTAA
ACTTGAGAAA TATTGATATG AAATTCAACA ACTTTCTTCA TCAGTTAATT TGGTGAGCAC TTGTTTTTCT GCAGTTCTCA
CCCACTTCAG AGCACATACT ATTGGCATAT GGTCGTCGTC ATAACTCTAT GCTTAGGAGC ATTGTGATGG ATGGGGAAAC
TGGAATTCCT GTATATACTA TCTTGGAGGT ACATATAGTT AGATTATGCA TAAGCATATC AGTGAAAATA CTGGAAATTC
TGTTTTTGCT GCTTATTTTA AATATTTCAG TCTGAACAAT TTTCTTATTA TAGTTTGTAA CTCCTAGTGT CCTTTTGTTT
CTGTATGACT AACAATATGA TTTAggccct gttctaaact tcaacttcct cattttccgt tagcacgctt cccaaactgc
tatacggtgt attttttgca aaatgttttt atataaaagt ttctttaaaa attcaaatga accctttttt caaatttata
atatttagtt attaattaat catgtgttaa ttgcttgctc cggtttctgt gccacTTACA AGCTCAGTTC TTACTTATGA
ATGAAGCCTT AATCTCATTA TTCCTATTCA TCACGTTAGG TCTATAGAGT ATCGGACATG GAGCTGGTAA GAGTTCTTCC
TAGTGCTGAA GATGAAGTAA ACGTTGCATG CTTTCATCCT TCCCCTGGAG GTGGTCTTGT TTATGGGACC AAGGTAAATA
GCAAATTAGA TCAATCAACA GTACACAACA TATATTTGCT TTGCTAATTC ATGCACTCAC ACATTTGCAT CAGGAAGGAA
AGCTCAGGAT CTTGCAGCAC AATGGTGCAG ATATCACAAG CACAGGGTTG AATTGCTTTA TCGAGGAAAA TATGCTTGAG
GTAGTCCTTT TTTCCCCAGT TGTCATATCC AAGGTTTTGA ATCCTAAAGA CTGGCAGTCG TATTTTGAAT TCAATTTAAT
TGGCATGTGT AATGTGTAAT TTTCATAGAT TTGTCATATA AGATACGTTA ATACATCACA ATTAGATTGA AACTGTCAAA
ATTAAAACTG TAGTGACATG CATATTTAAT ACTACAATAT TCCATATTCC TTTTGCACAA TATATATAAC CAAGATACCT
GTTTCATCTA ACATAACATT TTGAATACCG GTTTCGAAAA GAAAATACTG GTCCCTCCAG TTATGGGACA TGTTTGAGTC
CAAATATTTG AATTCCAAAA CCGGTTGGCA CATAAAATAC ATCAATGCAT CACAATTTGA CCAAAATGGT CAAAATGCAA
TCTTTTGTAG TGAAATGGTT TGTATCAAAT CCAACAGTCT ATATTCTTTT TGTGAAATAT ATGTATAACC AAGACATCGG
TTGTATCTAA CCGTATGACG GCAAGAGGCG TTGATTGAAA AGGGCTTGAG CTGCAGTGAC GAGTGATGGG AGTTTCATAT
TTTATTTCCT ATTTTCCTCG TTGAATGTGC CTATTTTTTT CCTACTCTAT CATATAATTC AAATGTACTT ACACATGTCA
CTGCAAGAAA ATATACAGTT TGTATTAAAA TTTTGTTTTA TTCTGGCTGG TATGCCAGAT ACCTGCTAGC CAGCAGATCC
TGAACGGTTA CCAGCTGGTT ACTGTTGGGA TTCCGATCTA TGATGGCAGG TGACATTGAC TAGACTGCCT CGAGCTGCAG
AAACAAGCAA CAAGGCTCTT TTTAGATTTC CCCTATTGAA TGCGTCTCTC CTTTTCGGTT GTTACACTTC TCTGTTACAA
ATGATGTTGC AAGAATATAT ACAGTTCGTA TGATTTATAA TTTAAAATTG AATTATTCTG GCCTGTACGT TGGATACTAG
CTGGTGGCTC TGGAGCGGTA ACTGTGCTGG TTATCGCCGG GATTCCGATC CCTGGTCATA CCTTGTTAAT TATCTGGTTT
ACTTAGTCTT ATATTGTACC ACCACAGCCA TATTTTATGC ATTTCTCGTG GCCCATGTGT CTGGTGGTGG TTTCATTCTC
TACACTGGAA GTTTAGTGGA TGTTTAACCA GCATTTACAT TTCTAAATGT AGGAATTCTG GATTTAACTA TCATGGGTTA
TGTCTGGATG AAAGTATGAA CTAGTTGCTA TTATGCATGG ACTCGTTCAA TGCTGGCTCT GGGCTTTAAG AAATTTACAA
AGCACGAATC ATGTTGTCTT CACAAATAAA CTAGTTGCTT TATCTTGGTT GTTGAGCCTA AGATAATCAG TTTGAGTGGC
ACTTTGCCAT ATGGATGCAG ATTTTTTTAA ACTAGTTATG TGGTTTTTGA TTTATCAAGG TCAATCACTT TTTTTTTATA
AGTAACTATA GGTTCAAATA TGCAAAGCTA AGACaagata gtccatgtta ttatgggttg tttggtttga tcagaattcg
gtccatcgta agatcgttcc tcaaatttgg ttcaatgact agtattcctc atttttccca cttagtatat atgatgacca
catttcattc cgcaaaccaa acttatttag gatcaagtgg tcaattgaca atctcattcg gccattcctc aaaccaaaca
GCCCTTTAGA GTTTTACTGG GTCTGTGTCC GAGCTCCAAC CCACTAAGGG GCATGTGTTA CCAAGTCCAT GCTATCAGCG
AGTTTCCACT TTACAGTAAT CTGGTACGAA ATAAAGTTGG AACTAAACAG CATGACAATT GGCCGAAATT TAACAATGGG
CCGAAATTTA ACAACGGGGA TGTTTTCTGA ACAAGTCATA AATGATGCAA CAGTTCACTC CGATTTTCAT GATAACTCTA
ATATATCTTT AAGCACACGA TAATGGAGTA CAGAAATTGG CATTATCCAT CACAAATAGG TCAAAATTGT CTTACCTCAT
TATTTCCAGG GAACTGTAAA TAAATTATTG ACCATGGATT TTCAGTTGGG CAATCATCAC TTTTTGGAGT CTTCTATTCA
TGTTAATAGT TAAGACTTTT GTCGTGGACA TTTAGCCACC ACAAACTTAG TTTTACTTGA TAACCTGTAT GATTTGCTAC
TTAATACATT TGAAGCCAAT GGTGGCCCAG TTATGGTTGC TAGATCTTTT GCAATTTTAA TCAGATTGTA TGCATTTGGC
TCACTTCTGC TGAAACTAGC AAGATTCTCA TAAATTAGTG TCCTATCTCA TATTTTATTA ATATGGTATC TATTAATAGG
GCAAACTTAG GGGCAGCAAC CAGACACCTG TGACCTGTCC AGATACAAGC CTTGTTAGGA GTTTATTTAT TTCCGTGAAA
ATCTTTCCTT TTGCTTGTAC CTCATTTAAT TTAATGCTAT TGTGTCAACA GGTTTGATAA TGATAGTGCT GCTATTATGT
GCTCATATTC GGTCTAATAA AATCGATATA ACGGTATGTT CCTTTCTTTG TTGTAGATTC AGAGATATGC GCTGGAAGGC
TGAACGATTG GTTGCCATGT GTTATGTGTA CTTCTCCAGG TAATTACCAT TTATCAACAT CTCAATTTTT TTTCTGTGTC
TGTTGCATTC CTGGCCTCAA ACGTTATCCA GTTCACTGGT TGGAGGGACA CTTTGCTGTT TCTGTTCCTT TTGGTCATGA
AGTATAATCA AACTTTCTGT CTATAGGTGA TACTATGACC AAATATGCCT TTTCTGGTTG GCTTGCTGGT GACTGAAATC
ATGATTGGTT GTCACTACAG GAATTTTCCT CTGCAAAGTT TATCATTGTA CAAGTGAGCC TCAAGGAAAT CATCAGATTT
CAGCAAAGTC ATGGCAGATT CTCAAATGAG TTTGCTAGAG TGCCTTGGGG ATAGGTATGG AACTGTTGCG TAATTTGGTT
TGGTGACAGT CTAAGATTAC CCATCTTGTT TTGTTCCACT AAACCCACCG ACATTGATAT CATCAAAAGA TCCCTATTGC
TCCTTAATAC CATTCCATCC AAGCCTTCTT TTTACCAAAA GCAATTATGT TAGATGAAAT AACATTCATT GGCATCTTGG
CTTTCCCTCC TATCTTCAGT GCAGATGGAC ATTGAAACAC AAACATACCA CACATTACTC ATTGTTAGCA ATGTGCAGTG
CCACTGTGTG CTAGAAAGCT TGAGTTTCTG GAGCTGCTCG ATCTCTATGC ACAGTGAGGC GATGAACATA CCACACATTA
CTCATTAGTC GGAGTAATGG CGATGGTGTG CTTGGTGGTG GGTCTTCATG CGGGATGCCT ACTTTTCATG GCTGCAGCGA
GGTGAAAAGC TTGTCAAAGC TTGTCAGTGC AGAGGTCCTT GATCTTGGTG TTGCCAGTGA AGACTGTGTT GGATACGTGT
CCTCATCTCT TCCCTCTTAA TTGCCAGCAC CACCCATTCA CCTTTGCCAT CATGTTAAGC ATCCTGCCAT GTCTCTGCAC
CACCTCATCC TCTCCCTAGG GTTGGCTGCA ACAATGTAGA GTGGAGACAG ACAAAACATG AGGGTGGTCA GAGTTGGGCA
CACACTTTAG ACCCCCCAAG CTGATATCTT TCTCTTCAAA CTCTGTCTTC GTTACAAAGT TCTCCGATTA CCATAGACCC
CCCAATCTAA TATCTTTCTC TTCAAACTTA GTCTTCATTA CAAAGTTCTC CGGTTACCAG ATCTTTTTTT GGTAAAGGTT
TGTCTTGAGA GGTCCGATAC CAGCTTTCAC ACTTAAATTG ATCTGTCTGG ATTAGCCAGG CCAAATTGTA GTGCCGAAAT
CGTTTTATGG CTGTTGCGAG CTTAGCCTTG GATGGAATGG TATTTGGATG GAATGATGTT AAGAGGAACA TGAGTGATCT
TTGGATGGTA TTAAAGTGCT CATGTGAATC AGTGGTATAA AACAAAGACG GTAATCTTTT GGTGTCACCA AACCAAAATT
TCCTTATAAT ATACCATAAT ACTCATGCTA TATAGGTGTA TGTATTTGCT TCTCTGCTGC TGGGTATGAT TAATATGAAT
TCATTATCTT TGTATGTGCA TGAGATTTAT CAATAAAATT TCTGCCACGC TAAAAGTAGA AATTACCCTG CACAGAATAA
TAGATGGCCC AGAAATATAA AACCTGCTTC AAATCAATAT TTTTAATTTT TGCTCGAGGG AGTAAAGGAG TCAGTGAAAC
AGGCTAGCTG TTTTGTTCTG GGAATTTTGT CGCGACCAGT TTGCCAGCAC GGCTTGGTAT GTTCAGGAAC AAATTGCCCT
TTATTCCTTG TATATAGTAA TTATATAAGG AATAATAATT ATGAGCTTAT ATATAGTAAT TATATACCCA AGGACACAAA
CTTATATACG TTGTTGCTAA CGTTTCTGCA TTGGGTACTT TTTTTTTTGT TGCAAACTGA CCATATAGCT GACCTGTGTT
ACACCTGTGC TATTATATTC TTTCCCGCCA AAGTGACTAG TTTTAATGGA TTGCCATTTG CAACTTAATT CAGGTCTGTG
CAGAGGGAGT TGGAAGATGT AAATCAACAC AACCATGTTG CTGCTGTCAA GTCATCACGA TGCTGTAATT ACAGAATTGT
ACATGTAATC TTTAATCAAC TTAACTTGTA TTTTAGAAAG CACACAATGC TAACCCTTTT CTTTTCAATG GCAGAGGTAT
TTATTGTTCC CCTTGTATTT TTCGTTGTGT AGTCTTTTAT TCCTTGACGG GGTACCAAAT GCCAATGATT AAAGTAACTA
ATCATCAATT CATCTTTGGT TCAAAGATGT ACTCTG