Os02t0291400-01

Locus

Os02g0291400

Description

Calcineurin B-like protein, Salt tolerance

RAP-DB Gene Symbol Synonym(s)

OsCBL8

RAP-DB Gene Name Synonym(s)

Calcineurin B-like protein 8

CGSNL Gene Symbol

CBL8

CGSNL Gene Name

CALCINEURIN B-LIKE PROTEIN 8

Oryzabase Gene Symbol Synonym(s)

OsCBL8

Oryzabase Gene Name Synonym(s)

Calcineurin B-like protein 8

Transcript Evidence

DQ201202

Protein Evidence

Q3HRN9

Literature

PMID: 18395997

Note

Manual Curation

January 28, 2021

Gene Ontology (GO)

Molecular Function: calcium ion binding (GO:0005509)

Functional domain (InterPro)

EF-hand domain pair (IPR011992)

EF-hand domain (IPR002048)

EF-Hand 1, calcium-binding site (IPR018247)

Experimentally confirmed subcellular location

plasma membrane (GO:0005886)

Expression Databases

TENOR (Os02t0291400-00)

Others

Oryzabase (6105)

KEGG (Os02t0291400-00)

Transcript

642 bp

>Os02t0291400-01 Calcineurin B-like protein, Salt tolerance
ATGGGCTGTGTATCATCAAAGCAGTTCAAAAGAGCTGCACAACATGAGGATCCTGCTATT
CTGGCCAAAGAGACTACATTTTCAGTGAGTGAAGTGGAGGCCCTCTTTGAGCTGTTCAAG
AAGATAAGCCATTCCATATTCAGAGATGGTCTCATTCACAAGGAGGAGTTCCAGCTAGCT
CTCTTCAGGAACAGCAACAAGAAGAACCTTTTCGCCAATCGGATATTTGATCTCTTTGAT
CTGAAGCGCAACGGTGTTATCGATTTCGGGGAGTTCGTTCGATCCCTCAGCATTTTTCAC
CCGGAAACGCCTTTGGGAGACAAGATTGCCTTTGCATTTAGGTTGTATGACCTGAGAGGA
ACTGGATGCATTGAACGTGAAGAGTTGCACGAAATGGTGCTTGCTCTTCTGAATGAATCA
GATCTATTCCTATCTGAAGAAGCTGTAGAACAAATCGTGGATCAGACGTTCAAGCAAGCA
GACTTAAACGATGACGGGAAGATCGACCCCGATGAATGGAAAACGTTTGCGAGTAAAAAC
CCGGCTTTGCTGAAGAACATGACTCTTCCATACCTAAAGGACATAACCATGGTATTCCCC
AGCTTTATTCTGAACTCTGAAGTTTGTGAGGAAGAGTTGTAA

CDS

642 bp

>Os02t0291400-01 Calcineurin B-like protein, Salt tolerance
ATGGGCTGTGTATCATCAAAGCAGTTCAAAAGAGCTGCACAACATGAGGATCCTGCTATT
CTGGCCAAAGAGACTACATTTTCAGTGAGTGAAGTGGAGGCCCTCTTTGAGCTGTTCAAG
AAGATAAGCCATTCCATATTCAGAGATGGTCTCATTCACAAGGAGGAGTTCCAGCTAGCT
CTCTTCAGGAACAGCAACAAGAAGAACCTTTTCGCCAATCGGATATTTGATCTCTTTGAT
CTGAAGCGCAACGGTGTTATCGATTTCGGGGAGTTCGTTCGATCCCTCAGCATTTTTCAC
CCGGAAACGCCTTTGGGAGACAAGATTGCCTTTGCATTTAGGTTGTATGACCTGAGAGGA
ACTGGATGCATTGAACGTGAAGAGTTGCACGAAATGGTGCTTGCTCTTCTGAATGAATCA
GATCTATTCCTATCTGAAGAAGCTGTAGAACAAATCGTGGATCAGACGTTCAAGCAAGCA
GACTTAAACGATGACGGGAAGATCGACCCCGATGAATGGAAAACGTTTGCGAGTAAAAAC
CCGGCTTTGCTGAAGAACATGACTCTTCCATACCTAAAGGACATAACCATGGTATTCCCC
AGCTTTATTCTGAACTCTGAAGTTTGTGAGGAAGAGTTGTAA

Protein

214 aa

>Os02t0291400-01 Calcineurin B-like protein, Salt tolerance
MGCVSSKQFKRAAQHEDPAILAKETTFSVSEVEALFELFKKISHSIFRDGLIHKEEFQLA
LFRNSNKKNLFANRIFDLFDLKRNGVIDFGEFVRSLSIFHPETPLGDKIAFAFRLYDLRG
TGCIEREELHEMVLALLNESDLFLSEEAVEQIVDQTFKQADLNDDGKIDPDEWKTFASKN
PALLKNMTLPYLKDITMVFPSFILNSEVCEEEL*

CDS

chr02:11059897..11059975 (- strand) : 79 bp

chr02:11059709..11059791 (- strand) : 83 bp

chr02:11059547..11059606 (- strand) : 60 bp

chr02:11059262..11059370 (- strand) : 109 bp

chr02:11059089..11059141 (- strand) : 53 bp

chr02:11058627..11058707 (- strand) : 81 bp

chr02:11058364..11058476 (- strand) : 113 bp

chr02:11057896..11057959 (- strand) : 64 bp

FASTA

>Os02t0291400-01 class=Sequence position=chr02:11057896..11059975 (- strand)
ATGGGCTGTG TATCATCAAA GCAGTTCAAA AGAGCTGCAC AACATGAGGA TCCTGCTATT CTGGCCAAAG AGACTACATG
TAGGATTTGA TTCACTGGAT ACACCATGGA AAAATATTTA CAGGTTCTCT TTTGGAAAAA CCCTGAATAA TAATAATTGT
AATTTATTGC TATTCTTCTT GCAGTTTCAG TGAGTGAAGT GGAGGCCCTC TTTGAGCTGT TCAAGAAGAT AAGCCATTCC
ATATTCAGAG ATGGTCTCAT TCACAAGGTA CTTGCTTAAA AAATCTGCTC AAACTTGTGA GATTGACCAT GTAGCTCTGA
AATTCTGATG AAAAATATGT CAATTGCAAA CGGCCCTTTC CATGTACAGG AGGAGTTCCA GCTAGCTCTC TTCAGGAACA
GCAACAAGAA GAACCTTTTC GCCAATCGGG TCAGTAGCAG TGATACCCAG TCCATTTCAT CAGTGGATTT TATTTCAACA
TATAGACCAT GATGTATTGG TGCAAAAAGG CATTATCTGA AGAAGCACAG TTCTACATAT GTTTGGCTGA ATTGTAGAAC
CTGTTCTTAT GTGAAAATGC TGACAGTGTT TCACCACAAG TGCAGATATT TGATCTCTTT GATCTGAAGC GCAACGGTGT
TATCGATTTC GGGGAGTTCG TTCGATCCCT CAGCATTTTT CACCCGGAAA CGCCTTTGGG AGACAAGATT GCCTGTAAGG
AGTTCCAGCT CTTTCTCATT ATATATGGTC AATTTAACCA TCTTGATTTT GTTTTCTTTA ATAACTACCT TCTGTTTATG
CCATTTTGGT ATTTGACAGT ATTCTTTTTT GTAGTTGCAT TTAGGTTGTA TGACCTGAGA GGAACTGGAT GCATTGAACG
TGAAGAGGTA TGCATTTTAG AAATTAGAAT TACTTATCAT CTTTTTAGTT CCATAAATCA AACATGCTAC CCATATACTG
TGTAGAAATG ATTCAACATA TAGTAATTTC CATGCATTAA TAGTCTACAG AACTGATGGT GACGGTACAC ATCTATACCA
TCAAAGAAAC ATAAATGGTG TGTTTCCAAA TATTTGTTGA ATCCAGTTGA TATTTAATTT AAATAAATCC TTACATATCC
ATAAGAAGCC TCAATtcaaa ctggctgagt gtgaaaaact ggaaatttgt atgtgTACCG TTGGAAAATA ATATGCATAC
CGTCTTACCG TTTTAACTGA CAGTCCTGGA GTTACTGAAA CTATTTTTCT TTCTTATGAA TCAAGCAGTT GCACGAAATG
GTGCTTGCTC TTCTGAATGA ATCAGATCTA TTCCTATCTG AAGAAGCTGT AGAACAAATC GTGGATCAGG TTAAGTGCAT
TCAGATTAAA TACTACCTTC AGTTTTTCTA TTTCCCAGGC ATTTTTTAGC AGATTTCAGT TCATTTCTTT CACAAAGTTG
CCACTGCTTT CATGAATAAA TCATATCATT AACCTTTATG CTAACTTGAG CTTTTACAGA CGTTCAAGCA AGCAGACTTA
AACGATGACG GGAAGATCGA CCCCGATGAA TGGAAAACGT TTGCGAGTAA AAACCCGGCT TTGCTGAAGA ACATGACTCT
TCCATACCTA AAGTAAGTCT GTCTACAAGT TTCAGGTTTC ACTCCAATTA CGTTTTACTG TTTTACATCA CTTTATCACT
AAATATAggg gctgttcagt ttgttaccat tttcaaccat atcaaattta gcattgtcaa attttggcaa ggtAGCAGTC
TAAGTACATC CCAAATACTC CACCATACCT TACCATGCCA AAATTTTGGT GATTTTCTAG AAACCTCTCG ACATAACACT
ATACAAGAAT ATTTAGCATA GTAACAAACC AAACAACACC CACACACTTT TCTACCCTAC CAaacttggc caaattttgg
tattgccaaa atttggaagg gttaattttg gcatcaaagt gaacaaaccc ataaAATTTG TAATTCTGAT GCCTAAATTG
TTCACTTTGT GTTCAGGGAC ATAACCATGG TATTCCCCAG CTTTATTCTG AACTCTGAAG TTTGTGAGGA AGAGTTGTAA

Locus: Os02g0291400

Loading...

Locus: Os02g0291400

Loading...