Os02t0304900-01

Locus

Os02g0304900

Description

Drought-induced 19 family protein, Drought resistance, Positive regulation of abscisic acid (ABA) response

RAP-DB Gene Symbol Synonym(s)

OsDi19-4

RAP-DB Gene Name Synonym(s)

drought-induced 19-4

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsDi19-4, Di19-4

Oryzabase Gene Name Synonym(s)

drought-induced 19-4, drought-induced 19 protein 4

Transcript Evidence

AK059764

AK099304

Protein Evidence

Q6H6E6

Literature

PMID: 27627618

PMID: 25236158

Note

Manual Curation

April 27, 2017

Functional domain (InterPro)

Protein DEHYDRATION-INDUCED 19 (IPR033347)

Drought induced 19 protein type, zinc-binding domain (IPR008598)

Protein dehydration-induced 19, C-terminal (IPR027935)

Experimentally confirmed subcellular location

nucleus (GO:0005634)

Full-length cDNA

006-203-G01 (Online Clone Ordering)

J023139M10 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0304900-01)

Others

Oryzabase (18579)

Transcript

1219 bp

>Os02t0304900-01 Drought-induced 19 family protein, Drought resistance, Positive regulation of abscisic acid (ABA) response
TTTTGGTTGGTGGTGCCGTGTAGAGGGGGAGGCGACGAGACGAGACGAGAGGAAGGAGAC
GAGACGATACGCGGAGATCCGGGCGGCGACCCGCGGAGGAGGAGGAGCCCGCGGCGCCAT
GGATTCCGACCACTGGATCTCCCGCCTCATGGCCGCCAAGCGCCAGTACGCGCTGCAGCG
CGCCCAGAATCACCACCACGCCACCGCCACCGCCACCGCCACCGCCGCGTCGCACTCCCA
CCTCGATCGGTATGGGTACGATGATGTTGAGCCAGAGGACGAGGTACGGCCAGACTTCCC
ATGTCCTTACTGCTATGAAGATCATGACATTACATCTCTTTGTGCCCATTTAGAGGATGA
GCACCCCTTTGAGTCTAAAGTTGTGGCTTGCCCGGTTTGCTCGGCTAGGATTTCAAAGGA
CTTATTGGATCACATAACCCTTCAGCACAGCTACCTGTTTAGACTGCAGAGACATCACAG
ATTACGCAGAGTTGCTGTTCCTAGCAACCATGCTCTCTCCCTTGGAGGGAGAGATCTACA
GGAGACCTACTTAAAGGTTCTTCTTGGAAACAGTAGTCGAAGCAGTGGTACCAATGCAGC
AAGTTCAGTCACTGATTCACTACTATCTTCACTTGTTTTAAATTTATCTTCATCCGAAGC
CGAAGATACAGCGAAATTTTCTGCTCTAGCTGTGGTAGAAAATAATTGGTTTAAAAGAAC
ACTGCCTTCAAAGACTTGGAAGGCAAGCTCTGATTCTAATCTTAGTCAGGAAGAAAGGGA
GAGAAGGCGGAGGCGAGCTGCAGTGAGATCATCTTTTGTACAGCACCTGCTTGTCTCTAC
CCTTTTTGATGACTAGCAGAAGAAAAAAAGAGCAGCTCCGTGCACTGGAATCTCGAGTGG
GCCTTTTGTCCACACATTTCTGGATGAATGATGAAGTAAAGCATCTTCCAAATCCTGAAG
CAGTTCATCCAACCGGAGGCTGGTTCCTGATCCTTTCGACATTGATGATGAACCGATGTG
GCTGGCCTCTTACTTGTCATGGAAGCAGTTCTGAACATTTATGTTCGAAATCCAATTCAG
ATTGCTAGGCTATCGACTAGCGTTACTGTATTGATTGTGTTATTCCATATGATTTCATTA
TGTGCTTAACAATACAATGAACATTACCCCCAATTTGATTCTTACTATAAACATTTCAAA
ATTGAATTCCATGTTTGGT

CDS

738 bp

>Os02t0304900-01 Drought-induced 19 family protein, Drought resistance, Positive regulation of abscisic acid (ABA) response
ATGGATTCCGACCACTGGATCTCCCGCCTCATGGCCGCCAAGCGCCAGTACGCGCTGCAG
CGCGCCCAGAATCACCACCACGCCACCGCCACCGCCACCGCCACCGCCGCGTCGCACTCC
CACCTCGATCGGTATGGGTACGATGATGTTGAGCCAGAGGACGAGGTACGGCCAGACTTC
CCATGTCCTTACTGCTATGAAGATCATGACATTACATCTCTTTGTGCCCATTTAGAGGAT
GAGCACCCCTTTGAGTCTAAAGTTGTGGCTTGCCCGGTTTGCTCGGCTAGGATTTCAAAG
GACTTATTGGATCACATAACCCTTCAGCACAGCTACCTGTTTAGACTGCAGAGACATCAC
AGATTACGCAGAGTTGCTGTTCCTAGCAACCATGCTCTCTCCCTTGGAGGGAGAGATCTA
CAGGAGACCTACTTAAAGGTTCTTCTTGGAAACAGTAGTCGAAGCAGTGGTACCAATGCA
GCAAGTTCAGTCACTGATTCACTACTATCTTCACTTGTTTTAAATTTATCTTCATCCGAA
GCCGAAGATACAGCGAAATTTTCTGCTCTAGCTGTGGTAGAAAATAATTGGTTTAAAAGA
ACACTGCCTTCAAAGACTTGGAAGGCAAGCTCTGATTCTAATCTTAGTCAGGAAGAAAGG
GAGAGAAGGCGGAGGCGAGCTGCAGTGAGATCATCTTTTGTACAGCACCTGCTTGTCTCT
ACCCTTTTTGATGACTAG

Protein

246 aa

>Os02t0304900-01 Drought-induced 19 family protein, Drought resistance, Positive regulation of abscisic acid (ABA) response
MDSDHWISRLMAAKRQYALQRAQNHHHATATATATAASHSHLDRYGYDDVEPEDEVRPDF
PCPYCYEDHDITSLCAHLEDEHPFESKVVACPVCSARISKDLLDHITLQHSYLFRLQRHH
RLRRVAVPSNHALSLGGRDLQETYLKVLLGNSSRSSGTNAASSVTDSLLSSLVLNLSSSE
AEDTAKFSALAVVENNWFKRTLPSKTWKASSDSNLSQEERERRRRRAAVRSSFVQHLLVS
TLFDD*

5'UTR

chr02:11885744..11885861 (- strand) : 118 bp

CDS

chr02:11885617..11885743 (- strand) : 127 bp

chr02:11884831..11884970 (- strand) : 140 bp

chr02:11883616..11883693 (- strand) : 78 bp

chr02:11883243..11883526 (- strand) : 284 bp

chr02:11882669..11882777 (- strand) : 109 bp

3'UTR

chr02:11882306..11882668 (- strand) : 363 bp

FASTA

>Os02t0304900-01 class=Sequence position=chr02:11882306..11885861 (- strand)
TTTTGGTTGG TGGTGCCGTG TAGAGGGGGA GGCGACGAGA CGAGACGAGA GGAAGGAGAC GAGACGATAC GCGGAGATCC
GGGCGGCGAC CCGCGGAGGA GGAGGAGCCC GCGGCGCCAT GGATTCCGAC CACTGGATCT CCCGCCTCAT GGCCGCCAAG
CGCCAGTACG CGCTGCAGCG CGCCCAGAAT CACCACCACG CCACCGCCAC CGCCACCGCC ACCGCCGCGT CGCACTCCCA
CCTCGGTATA CCTTGCCTTG ATTTCTTCCC CTTTCTTGAT CCGGCGTAGA AAGCCAAGCC GCGATTTTTT GTTTCCCTGA
GCGGAAGATT TTGGTCTGGC CGCGGAGGAT GGATGTCCCC TTTCCGGATC TCTCGATTCG TCGTCGCTAG TTTGAGTCTT
TTGAGGCTCG GTTTGTGATG GGTTGATTTC TAGGAATTCG ATTGATTTGT GTTTGGATTC ATGTTGTTTC GGTGAGGACC
AATAAGAGGA GGATTGAGCA TGCATCGTTG TTTCGTCTCA TTTGGCTCCA TTTCTTGGTT TTGAACTTTT GATGGGGGCC
TATTTGACTC GTCTGAAAGA TTTGACCTTT GATGAAATGC ACCTATGCCA AACGTGATAA TCTTTTGAAT ACTCAGTGCG
TTCATATTGA TTTTCCGTTT TTGAAATGCT ACGTTTTCCC TGTTCAAATG TAAGTCGCGA AATGACGCTT TCGGATTTGG
TTTGACAATA TTGCGTTATT TCTTTCTTCG GATATTTGCA ATTATTTGAG ATTGGTTTGC TTTCTTCTGG TTCTTGATGT
TCTATTTGTT TGCCTTATGG AGACCTGATT GAAATTAACA TTCATTTTAT ACTATCTAAC TTTTGCATGT CTTAAATTAA
TTCACTTGCA GATCGGTATG GGTACGATGA TGTTGAGCCA GAGGACGAGG TACGGCCAGA CTTCCCATGT CCTTACTGCT
ATGAAGATCA TGACATTACA TCTCTTTGTG CCCATTTAGA GGATGAGCAC CCCTTTGAGT CTAAAGTTGT GGTAAGTATC
TCTGCTTTCT ACTCTCTTTC TGTATTTTCT TATATGCTTC TTTTATCTGA AGTCAGTCAA ATGTGTGAGA AATCATATCC
ACTCCTTTTG TTTCTTTCAT TTTGGATAGC CATAGATTAA CCTTGTAGAA CTCGAGTAGG TTACTAAATT TCGTTGTGAA
TAATCAGTGT TTTGTTACTA CATGGAGATA TTGAATTAAT ACATAAATGA TGGAGAGAGA TTGTGAGAAG AAGCTAAATG
GAAATACTCA TATTTTGCAG TTGTTACACA TTGGCTACAT GAACCTTTAG GTTAAAGTTT AACTTTGATG TGTATTGGAC
CGTTCTGATA TGATTGCCTT AATTTGTTGT GTTGCATATG CTGTATAATT TGTTACTTAA TTTATAGTTG TATGCTGCAG
GAATGATTTG TTTTAATTCT TATCCAATGT CATCTCTTTA AATGATCCAT TTAAATGTTG AGAGGTTTCT CTATGAATGT
TTAAAGGCTG GGCTTGCAAT ACCCAGGTAC CAATATGTTA TTTGCATAGT TTAATCTCTC TCTAAAATGA TTAATTTAAC
AGACAGTATT TGATCTAGGA CAAAGAAAAC ACTAATGCCT AGATATTCAT TTTAAAGACA GAACATACAA TTAAGGCATA
GATCTTCTTT TCTAGCCAGA CCAGACAATT AGAACTCAAT TGTTCCTTTT GCCATAAGGA TACTATACTA AGGGGACTAA
GGGTTGGTTT GGGATTGGCA TACTGCGCTG GACTAACTGG GAACACGGTT ATACTGGAAA CTGTGGAAAC TGCTGGTATA
AAAAATCAAG CTCCTTCTGA AGGTGCATCG AAGTATCGAA CTATAGTCAA GTTTGGTGCT ATCAATTTTC TGAAGACATG
AACATTTGTC AGTAACGTGA TTTAGTACCG AATATGTTCA TTTCAATAGT GAAAACAACA TCATGATGCA CACAAGCAAG
ATATTTACAC AGTTCTTATA TAGGATTAAG CCAAAAACCA GATTCAGGGC TTATAAATTA AAAAAGTCAG CCAGCTTTTG
GTACAATAAC GAGGTGGACC TAATACTCCT TCCATATGAT ATATTCTGTA GTTCCTACTC CCTAACCATA CTTGTATACT
CTCCACAGGC TTGCCCGGTT TGCTCGGCTA GGATTTCAAA GGACTTATTG GATCACATAA CCCTTCAGCA CAGCTACCTG
TTTAGAATAT CCTTTTTGAG ATGTTAAAAG TCTCTAAATT CTGTATCATG TTTTGTGAAC TGTTATTTTC ATATGTTTCC
TTAATGGTGT ATTACCTGCA GAGACATCAC AGATTACGCA GAGTTGCTGT TCCTAGCAAC CATGCTCTCT CCCTTGGAGG
GAGAGATCTA CAGGAGACCT ACTTAAAGGT TCTTCTTGGA AACAGTAGTC GAAGCAGTGG TACCAATGCA GCAAGTTCAG
TCACTGATTC ACTACTATCT TCACTTGTTT TAAATTTATC TTCATCCGAA GCCGAAGATA CAGCGAAATT TTCTGCTCTA
GCTGTGGTAG AAAATAATTG GTTTAAAAGA ACACTGCCTT CAAAGACTTG GAAGGCAAGG TATGATCAAT ACCTTCCTGT
GTGCTACTAG TACTATTTTT GTGCCTTGTA TGGTTTTCTA GGTCTTAATC CCAGATAAAA TTATTATAAC TTTGTGAACA
AATAATCCTC AATTTACCAG TTCAGATATG CTTTCCGATA CTCAAAATTG TAGATCTGCT TGGCCTAGAT TTCATTCCTA
CCAATTGTGT TACTGTTTGT ACATCCTAAA GTTCATTTGT ATGCTATAAA TTGTGTAAGT AAACTCAGCT TATAAGTCAC
TATAAACTTG TGAGCTCTAT TGATCCACAC TAAAGTTGGT TTATCTATAA CTATACTAAT ATGGCAATCT GAGGAAATTC
CCACTAATAA ATCTGACCAT CTATCTAGGT GGGACCAAGT TATTATTTGG TTTATACACA CTGACATTGA GCTCGTCATG
CTCTATGAAC AAGAGCGTAT GTTAATCGAC TATCTTTCTT GCAGCTCTGA TTCTAATCTT AGTCAGGAAG AAAGGGAGAG
AAGGCGGAGG CGAGCTGCAG TGAGATCATC TTTTGTACAG CACCTGCTTG TCTCTACCCT TTTTGATGAC TAGCAGAAGA
AAAAAAGAGC AGCTCCGTGC ACTGGAATCT CGAGTGGGCC TTTTGTCCAC ACATTTCTGG ATGAATGATG AAGTAAAGCA
TCTTCCAAAT CCTGAAGCAG TTCATCCAAC CGGAGGCTGG TTCCTGATCC TTTCGACATT GATGATGAAC CGATGTGGCT
GGCCTCTTAC TTGTCATGGA AGCAGTTCTG AACATTTATG TTCGAAATCC AATTCAGATT GCTAGGCTAT CGACTAGCGT
TACTGTATTG ATTGTGTTAT TCCATATGAT TTCATTATGT GCTTAACAAT ACAATGAACA TTACCCCCAA TTTGATTCTT
ACTATAAACA TTTCAAAATT GAATTCCATG TTTGGT

Locus: Os02g0304900

Loading...

Locus: Os02g0304900

Loading...