Os02t0311150-00

Locus

Os02g0311150

Description

BTB/POZ-like domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsMB3, MB3

Oryzabase Gene Name Synonym(s)

MATH-BTB protein 3, MDC protein with a BTB domain 3, MDC protein having BTB domain 3

Transcript Evidence

AK372544 (DDBJ)

Protein Evidence

Q6YYI9 (UniProt)

Literature

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

BTB/POZ-like (IPR000210)

MATH (IPR002083)

TRAF-like (IPR008974)

BTB/POZ fold (IPR011333)

BTB/POZ (IPR013069)

TRAF-type (IPR013322)

Expression Databases

TENOR (Os02t0311150-00)

Others

Oryzabase (21197)

Transcript

1192 bp

>Os02t0311150-00 BTB/POZ-like domain containing protein.
ATGCTCCATCCATCTCCAGAATCACATCCTACCTTCAGAATGACAGACAACTGCAACACT
TTCTCCACCATTGTCGCGGAGGCCGTGAGCGGGTCACATGTGATCAAGATAGCTGGGTAC
TCAAGAATCAAGGTGTTACTCCGCAACGGTGAGTCCCTGACATCCATCCCTTTCAGCGTT
GCAGGCCACAGCTGGACCATCAGATTCTACCCCAACGGTGATTCCGCGGAGAGCCAAGAT
TACCTATCGTTCTATCTGATCCTTGACTCCGCCAATTCCTACGACGTGAAGGTGATTTTC
AGCTTCGAGTTGCTTGGCAAGAATGGGAGATCAGTGTCGTCTTACAGCTTCACTACAGAT
CTCCGCACCTTCTCCTACAAAGGCTCATTGTGGGGATACAACAAGTTCATTCACCAAACG
GTATTGGAAGAATCGTCAGCCCATTTAAGAGACGATTCGTTTTCCATCAGGTGTGACATC
AAAGTGTTCAAGGAGATCTACAGCCAAGAAACCAAGGGTGTTCATAGCAAGTTTGTGGAG
GTTCCTCCAAGCAACCTGCATCAACATCTAGGCAACCTCCTAGACAGCATGGATGGATCA
GACGTGGTCTTCGAGGTcggcgaggagagattctctgctcataggtgcgttcttgctgct
cggtcatcggtcttcaaggccgagcttcttggcaccatgaaggagaaagccgatggagcc
attcaagtcgatgatatggagcctggagtgtttaagtctttgctgcatttcatttacacc
gattccctggacacgatggctcaagaagatcagagcagagacgaagcaagcgaggaggag
gatttggtgatggctcagcatctacttgtcgcagcggaccggtacaacgtcgagagactg
aagctgatatgcgaggagaagctatgcgagagcattgactccagcatggtggcaaccagt
ttggcgttagctgagcagcacaattgcaatgggctcaaggaagcttgctttgagttcctt
gcatctccttccaacctactggagatgatggcaagcgatggttatgaccatcttaaaacc
agctgcccTGCTGTTCTCAAGGAGCTCACTACAAGATTTCTGCCTCCGGAAACGAAAGCA
TCAGAAGAGATAACCATTGGTCTATATAATTAGTTCTTCAAGTATGCTTATT

CDS

1173 bp

>Os02t0311150-00 BTB/POZ-like domain containing protein.
ATGCTCCATCCATCTCCAGAATCACATCCTACCTTCAGAATGACAGACAACTGCAACACT
TTCTCCACCATTGTCGCGGAGGCCGTGAGCGGGTCACATGTGATCAAGATAGCTGGGTAC
TCAAGAATCAAGGTGTTACTCCGCAACGGTGAGTCCCTGACATCCATCCCTTTCAGCGTT
GCAGGCCACAGCTGGACCATCAGATTCTACCCCAACGGTGATTCCGCGGAGAGCCAAGAT
TACCTATCGTTCTATCTGATCCTTGACTCCGCCAATTCCTACGACGTGAAGGTGATTTTC
AGCTTCGAGTTGCTTGGCAAGAATGGGAGATCAGTGTCGTCTTACAGCTTCACTACAGAT
CTCCGCACCTTCTCCTACAAAGGCTCATTGTGGGGATACAACAAGTTCATTCACCAAACG
GTATTGGAAGAATCGTCAGCCCATTTAAGAGACGATTCGTTTTCCATCAGGTGTGACATC
AAAGTGTTCAAGGAGATCTACAGCCAAGAAACCAAGGGTGTTCATAGCAAGTTTGTGGAG
GTTCCTCCAAGCAACCTGCATCAACATCTAGGCAACCTCCTAGACAGCATGGATGGATCA
GACGTGGTCTTCGAGGTcggcgaggagagattctctgctcataggtgcgttcttgctgct
cggtcatcggtcttcaaggccgagcttcttggcaccatgaaggagaaagccgatggagcc
attcaagtcgatgatatggagcctggagtgtttaagtctttgctgcatttcatttacacc
gattccctggacacgatggctcaagaagatcagagcagagacgaagcaagcgaggaggag
gatttggtgatggctcagcatctacttgtcgcagcggaccggtacaacgtcgagagactg
aagctgatatgcgaggagaagctatgcgagagcattgactccagcatggtggcaaccagt
ttggcgttagctgagcagcacaattgcaatgggctcaaggaagcttgctttgagttcctt
gcatctccttccaacctactggagatgatggcaagcgatggttatgaccatcttaaaacc
agctgcccTGCTGTTCTCAAGGAGCTCACTACAAGATTTCTGCCTCCGGAAACGAAAGCA
TCAGAAGAGATAACCATTGGTCTATATAATTAG

Protein

391 aa

>Os02t0311150-00 BTB/POZ-like domain containing protein.
MLHPSPESHPTFRMTDNCNTFSTIVAEAVSGSHVIKIAGYSRIKVLLRNGESLTSIPFSV
AGHSWTIRFYPNGDSAESQDYLSFYLILDSANSYDVKVIFSFELLGKNGRSVSSYSFTTD
LRTFSYKGSLWGYNKFIHQTVLEESSAHLRDDSFSIRCDIKVFKEIYSQETKGVHSKFVE
VPPSNLHQHLGNLLDSMDGSDVVFEVGEERFSAHRCVLAARSSVFKAELLGTMKEKADGA
IQVDDMEPGVFKSLLHFIYTDSLDTMAQEDQSRDEASEEEDLVMAQHLLVAADRYNVERL
KLICEEKLCESIDSSMVATSLALAEQHNCNGLKEACFEFLASPSNLLEMMASDGYDHLKT
SCPAVLKELTTRFLPPETKASEEITIGLYN*

CDS

chr02:12218391..12219563 (+ strand) : 1173 bp

3'UTR

chr02:12219564..12219582 (+ strand) : 19 bp

FASTA

>Os02t0311150-00 class=Sequence position=chr02:12218391..12219582 (+ strand)
ATGCTCCATC CATCTCCAGA ATCACATCCT ACCTTCAGAA TGACAGACAA CTGCAACACT TTCTCCACCA TTGTCGCGGA
GGCCGTGAGC GGGTCACATG TGATCAAGAT AGCTGGGTAC TCAAGAATCA AGGTGTTACT CCGCAACGGT GAGTCCCTGA
CATCCATCCC TTTCAGCGTT GCAGGCCACA GCTGGACCAT CAGATTCTAC CCCAACGGTG ATTCCGCGGA GAGCCAAGAT
TACCTATCGT TCTATCTGAT CCTTGACTCC GCCAATTCCT ACGACGTGAA GGTGATTTTC AGCTTCGAGT TGCTTGGCAA
GAATGGGAGA TCAGTGTCGT CTTACAGCTT CACTACAGAT CTCCGCACCT TCTCCTACAA AGGCTCATTG TGGGGATACA
ACAAGTTCAT TCACCAAACG GTATTGGAAG AATCGTCAGC CCATTTAAGA GACGATTCGT TTTCCATCAG GTGTGACATC
AAAGTGTTCA AGGAGATCTA CAGCCAAGAA ACCAAGGGTG TTCATAGCAA GTTTGTGGAG GTTCCTCCAA GCAACCTGCA
TCAACATCTA GGCAACCTCC TAGACAGCAT GGATGGATCA GACGTGGTCT TCGAGGTcgg cgaggagaga ttctctgctc
ataggtgcgt tcttgctgct cggtcatcgg tcttcaaggc cgagcttctt ggcaccatga aggagaaagc cgatggagcc
attcaagtcg atgatatgga gcctggagtg tttaagtctt tgctgcattt catttacacc gattccctgg acacgatggc
tcaagaagat cagagcagag acgaagcaag cgaggaggag gatttggtga tggctcagca tctacttgtc gcagcggacc
ggtacaacgt cgagagactg aagctgatat gcgaggagaa gctatgcgag agcattgact ccagcatggt ggcaaccagt
ttggcgttag ctgagcagca caattgcaat gggctcaagg aagcttgctt tgagttcctt gcatctcctt ccaacctact
ggagatgatg gcaagcgatg gttatgacca tcttaaaacc agctgcccTG CTGTTCTCAA GGAGCTCACT ACAAGATTTC
TGCCTCCGGA AACGAAAGCA TCAGAAGAGA TAACCATTGG TCTATATAAT TAGTTCTTCA AGTATGCTTA TT

Locus: Os02g0311150

Loading...

Locus: Os02g0311150

Loading...