Os02t0312600-01

Locus

Os02g0312600

Description

Rac-like GTP-binding protein 7.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RAC7

CGSNL Gene Name

RAC/ROP-TYPE GTPASE 7

Oryzabase Gene Symbol Synonym(s)

OSRAC7, OsRac7, ROP5, OsRop5

Oryzabase Gene Name Synonym(s)

small GTP-binding protein 7, Rac-like GTP-binding protein 7, GTPase protein ROP5

Transcript Evidence

AK058414 (DDBJ, Best hit)

Protein Evidence

Q6Z7L8 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: GTP catabolic process (GO:0006184)

Biological Process: signal transduction (GO:0007165)

Biological Process: small GTPase mediated signal transduction (GO:0007264)

Biological Process: protein transport (GO:0015031)

Cellular Component: intracellular (GO:0005622)

Cellular Component: membrane (GO:0016020)

Molecular Function: GTPase activity (GO:0003924)

Molecular Function: GTP binding (GO:0005525)

Functional domain (InterPro)

Small GTPase superfamily (IPR001806)

Small GTPase superfamily, Rho type (IPR003578)

Small GTPase superfamily, Rab type (IPR003579)

Small GTP-binding protein domain (IPR005225)

Small GTPase superfamily, Ras type (IPR020849)

Full-length cDNA

001-015-D01 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0312600-01)

RiceXPro (AK058414)

Others

Oryzabase (6292)

KEGG (Os02t0312600-01)

Transcript

855 bp

>Os02t0312600-01 Rac-like GTP-binding protein 7.
ATCCATCAGGACCATCACTACCACCACTTCACCACCAAACCCAACCAAGAACAAGTTTTC
AGGGGCAAATTAAGAAGAGCTTGGTGACGATATGAGCACGGCGAGGTTCATCAAGTGCGT
CACCGTCGGCGACGGCGCCGTCGGCAAGACATGCATGCTCATCTCCTACACCAGCAACAC
TTTCCCCACGGATTATGTGCCGACGGTTTTCGACAACTTCAGCGCCAACGTGGTCGTCGA
CGGCAACACGGTGAACCTTGGGCTCTGGGATACTGCTGGACAAGAGGATTACAATAGGCT
GAGGCCTCTCAGCTACAGAGGAGCTGATGTCTTTTTACTAGCATTTTCCCTCATCAGCAA
AGCGAGCTATGAGAATATTCACAAGAAGTGGATACCAGAGCTGAGGCATTATGCTCCTAA
TGTGCCAATCGTATTAGTTGGAACCAAGCTTGACTTGCGTGAGGACAAGCAGTTCTTCCT
GGACCACCCTGGTCTAGCACCTATTTCCACTGCACAGGGGGAGGAGCTGAAGAGGATGAT
AGGTGCTGCGGCGTACATCGAATGCAGCTCCAAGACGCAGCAGAATGTGAAATCAGTATT
CGACTCGGCGATCAAAGTTGTACTTTGCCCGCCAAAGCCGAAGAAGAAGAACACCAGGAA
GCAGAGGAGTTGCTGGATCCTATGAGTGATAAACAGCAAGATTGGCGTATTCCGCAGGAA
ACCTGTATTATTTTTACAGTGTGTGTTGTGTTATGTTTGTGTGTTGCAGATTAGATGCAG
TTTGGGTTACAAAATTTGCTGGGTCTGAAATATTCAGCTCAGTGCTTCTTGAGTACTACC
TCTGATGATTCTTAC

CDS

594 bp

>Os02t0312600-01 Rac-like GTP-binding protein 7.
ATGAGCACGGCGAGGTTCATCAAGTGCGTCACCGTCGGCGACGGCGCCGTCGGCAAGACA
TGCATGCTCATCTCCTACACCAGCAACACTTTCCCCACGGATTATGTGCCGACGGTTTTC
GACAACTTCAGCGCCAACGTGGTCGTCGACGGCAACACGGTGAACCTTGGGCTCTGGGAT
ACTGCTGGACAAGAGGATTACAATAGGCTGAGGCCTCTCAGCTACAGAGGAGCTGATGTC
TTTTTACTAGCATTTTCCCTCATCAGCAAAGCGAGCTATGAGAATATTCACAAGAAGTGG
ATACCAGAGCTGAGGCATTATGCTCCTAATGTGCCAATCGTATTAGTTGGAACCAAGCTT
GACTTGCGTGAGGACAAGCAGTTCTTCCTGGACCACCCTGGTCTAGCACCTATTTCCACT
GCACAGGGGGAGGAGCTGAAGAGGATGATAGGTGCTGCGGCGTACATCGAATGCAGCTCC
AAGACGCAGCAGAATGTGAAATCAGTATTCGACTCGGCGATCAAAGTTGTACTTTGCCCG
CCAAAGCCGAAGAAGAAGAACACCAGGAAGCAGAGGAGTTGCTGGATCCTATGA

Protein

198 aa

>Os02t0312600-01 Rac-like GTP-binding protein 7.
MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD
TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENIHKKWIPELRHYAPNVPIVLVGTKL
DLREDKQFFLDHPGLAPISTAQGEELKRMIGAAAYIECSSKTQQNVKSVFDSAIKVVLCP
PKPKKKNTRKQRSCWIL*

5'UTR

chr02:12326654..12326744 (- strand) : 91 bp

CDS

chr02:12326555..12326653 (- strand) : 99 bp

chr02:12326377..12326464 (- strand) : 88 bp

chr02:12325854..12325963 (- strand) : 110 bp

chr02:12325697..12325760 (- strand) : 64 bp

chr02:12325554..12325618 (- strand) : 65 bp

chr02:12325264..12325329 (- strand) : 66 bp

chr02:12324766..12324867 (- strand) : 102 bp

3'UTR

chr02:12324596..12324765 (- strand) : 170 bp

FASTA

>Os02t0312600-01 class=Sequence position=chr02:12324596..12326744 (- strand)
ATCCATCAGG ACCATCACTA CCACCACTTC ACCACCAAAC CCAACCAAGA ACAAGTTTTC AGGGGCAAAT TAAGAAGAGC
TTGGTGACGA TATGAGCACG GCGAGGTTCA TCAAGTGCGT CACCGTCGGC GACGGCGCCG TCGGCAAGAC ATGCATGCTC
ATCTCCTACA CCAGCAACAC TTTCCCCACG GTGAGCTGAG CTCCATGGTG TTCTTGTTCT TGGCTTCTGC TGAATCTTGA
GGCTTTTCTC ATGGTTGGTT CTTTCTCCTT TTGGGGTTAG GATTATGTGC CGACGGTTTT CGACAACTTC AGCGCCAACG
TGGTCGTCGA CGGCAACACG GTGAACCTTG GGCTCTGGGA TACTGCTGGT ATGTGTTGGA TTTCAGGAAA AAAAAGTTGC
ACATTTGTCT GCATGCTTCA ATGTTCTGTT TTTTATTTTT GTTTAGTAGT ATAACTGATT TAGAAGAGAA GTCCAATTTT
ATAGATTTTA TCATGGCATG CTATTTTTTT TGGATTTTCA TTGCCCCTGC ACTTGATGCT AGTTTTCTTA TAATGACACA
TAGTACATGT CCATAGTATA TTCAGATTTT CCCTCTGCGA ATACTACTTT AGATTCTGTA GTTATCAGCA TATCATACAA
AAAACCAGGT GATCTAATTA ATGAAAAAAC TGTATCAGTT TCAATTGTTT TTTTTTTAAA TAGCAAAACA AATATACAAC
CTTCTCCGCG TTGAGGAAAT CGAATCTGTA TTTTCTGACA ACTAATTGTT GGCCTTTACA GGACAAGAGG ATTACAATAG
GCTGAGGCCT CTCAGCTACA GAGGAGCTGA TGTCTTTTTA CTAGCATTTT CCCTCATCAG CAAAGCGAGC TATGAGAATA
TTCACAAGAA GGTTACACAT TACTCAACTA CAAAACTACT CTTTGATTTT CTCCCTAATA CTTTCTCCTA ATTTTGACAA
ATCATTTCCC CCCATGTTGA GCAGTGGATA CCAGAGCTGA GGCATTATGC TCCTAATGTG CCAATCGTAT TAGTTGGAAC
CAAGCTTGGT AAGATGACCT GGCATTTTTT ACAAACAGAA GAAAAAACAT TGGCAACAAA ATCTGATAAG AACCGAATAC
TTGCAGACTT GCGTGAGGAC AAGCAGTTCT TCCTGGACCA CCCTGGTCTA GCACCTATTT CCACTGCACA GGTCAGTTCA
ACTTAAAAAC ATAACAATTC GCAACGCAAA AAGCGATACG TGATCGAAAT CCACAAGTAT CATATACTCC ACCCAATATG
AGAGGCATAT GCTCAAGTTT TTCTACGTTT CAGTTCATGT GCACAACACA ATAATCACCT TTTGCAATCT TGCACATTAA
GATCAGAATT TGGTATGACA GCAACTGAGC CCTTCCTGCT GCTGTACATG AACAGGGGGA GGAGCTGAAG AGGATGATAG
GTGCTGCGGC GTACATCGAA TGCAGCTCCA AGACGCAGCA GGTATGAAGA ACATGGACGA GTTGGTATAA CAGTACTGTA
CCATTCATGG ATTTAGTTTG TTAGTTCAGA GATATTGCTA CCTGACATTG TTCATCCACA CAGCATTATA TATAGTATGG
ACCAAGCTGG TGCTACTTTT AGGTAGTCCA AAGCCGGTTA GATAATATAG AAGCAACGGG AACCAAGTAC ATACTTATTA
TATATCTGAA ACTGTCCTCA TAATTTGCTA TAGTATAAGT GTAAGCCTTG TATGTGTTTT GGGGTGAGTG GGGGACTTTT
CAGCTCCCCT TCTCGtgttt ttttttctct cttaatgaaa tgatacgcag atctcatgcg tattcaagaa aaaaaaaTTG
TATCGGTTTT AATGGTGATT GATATCTTGA TGAACAGAAT GTGAAATCAG TATTCGACTC GGCGATCAAA GTTGTACTTT
GCCCGCCAAA GCCGAAGAAG AAGAACACCA GGAAGCAGAG GAGTTGCTGG ATCCTATGAG TGATAAACAG CAAGATTGGC
GTATTCCGCA GGAAACCTGT ATTATTTTTA CAGTGTGTGT TGTGTTATGT TTGTGTGTTG CAGATTAGAT GCAGTTTGGG
TTACAAAATT TGCTGGGTCT GAAATATTCA GCTCAGTGCT TCTTGAGTAC TACCTCTGAT GATTCTTAC

Locus: Os02g0312600

Loading...

Locus: Os02g0312600

Loading...