Os02t0325600-01

Locus

Os02g0325600

Description

Nitrate-inducible and autorepressible transcriptional repressor, Nitrogen response

RAP-DB Gene Symbol Synonym(s)

NIGT1

RAP-DB Gene Name Synonym(s)

NITRATE-INDUCIBLE, GARP-TYPE TRANSCRIPTIONAL REPRESSOR 1, Nitrate-Inducible, GARP-type Transcriptional Repressor 1

CGSNL Gene Symbol

NIGT1

CGSNL Gene Name

NITRATE-INDUCIBLE, GARP-TYPE TRANSCRIPTIONAL REPRESSOR 1

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

"Nitrate-Inducible, GARP-type Transcriptional Repressor 1"

Transcript Evidence

AK101809

Protein Evidence

Q6Z869

Literature

PMID: 23324170

Note

Manual Curation

November 27, 2014

Gene Ontology (GO)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: chromatin binding (GO:0003682)

Functional domain (InterPro)

Homeodomain-like (IPR009057)

SANT/Myb domain (IPR001005)

Myb domain (IPR017930)

Myb domain, plants (IPR006447)

Full-length cDNA

J033066M05 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0325600-01)

Others

Oryzabase (20509)

KEGG (Os02t0325600-01)

Transcript

1691 bp

>Os02t0325600-01 Nitrate-inducible and autorepressible transcriptional repressor, Nitrogen response
CCGTCCGTTCGATTCGACGACACCTTCATTTTTATTTTCTTCCTTGTGTAATAAGAAGAC
GACTAGTGGTAACAAAAAGATTCGCTCCCTACGCGACGCCCCGACCCCGATTCCCTTCGC
TTCCTACTCCTTCCTCTTCCTTGTTCCTTCCTTCCTTCCTCACCCCACGAACGCGCACAC
CAACCTTTCCCATCCCTAGCTGCTGCCCTTCCATCGGATCCACGGATCGAGACCTGGCAC
GGCGGCGGAGGACGGGCCGGCGGAGATGGAGGTGGACCACGCGGACCGCGACGGCGCGCG
GCGCCGGTGCCGCGAGTACCTGCTCGCGCTCGAGGAGGAGCGCCGCAAGATCCAGGTGTT
CCAGCGGGAGCTCCCTCTCTGCTTCGACCTCGTCACCCAGACTATCGAGGGGATGAGGAG
CCAGATGGACGCCGCCGGCAGCGAGGAGACGGTCAGCGACCAGGGCCCGCCGCCGGTGCT
CGAGGAGTTCATCCCGCTCAAGCCCAGCCTCTCGCTGTCCTCCTCCGAGGAGGAGAGCAC
CCACGCCGACGCCGCCAAGTCAGGCAAGAAGGAGGAGGCCGAGACGTCGGAGAGGCATTC
GTCGCCGCCGCCGCCGCCGCCGGAGGCCAAGAAGGTGACGCCGGATTGGCTCCAGTCCGT
GCAGCTCTGGAGCCAAGAAGAACCCCAGCAGCCATCGTCTCCTAGCCCAACTCCTACCAA
GGATTTACCGTGCAAGCCGGTGGCGCTGAACGCCAGGAAGGCCGGCGGAGCGTTCCAGCC
GTTCGAGAAGGAGAAGCGCGCCGAGCTGCCGGCGTCGTCGACCACGGCCGCGGCGAGCTC
GACCGTGGTCGGAGACAGCGGCGACAAGCCCACCGATGATGACACGGAGAAACACATGGA
GACGGACAAGGACAACGACAAGGACGCCAAGGACAAGGACAAGGAAGGCCAGTCGCAGCC
TCACCGGAAGCCTCGCCGGTGCTGGGCGCCGGAGCTCCACCGCCGCTTCCTGCAAGCGCT
GCAGCAGCTGGGCGGGTCCCATGTAGCGACGCCCAAGCAGATCCGGGAGCTGATGAAGGT
GGATGGCCTCACCAACGACGAGGTCAAGAGCCATTTGCAGAAGTATCGTCTACACACGAG
GAGGCCGAGCTCGACggggcagagcagcgccgcagccggcgtccccgccccgcctgcgcc
gcagttcgtcgtcgtcgggagcatctgggtacccccgccggaatacgctgccgcggccgc
cgcacagcagcacgtgcagcttgccgccgccggcaataatgcgtccgggagcgccaaccc
cgtgtacgctccggtggcgatgctgccggcaggctTGCAGCCGCATTCGCATCGGAAGCA
GCACCAGCAGCAGCAGCAAGGACAGAGACATTCCGGGTCGGAAGGCCGGCGGAGCGGGGA
CGCCGGCGATGGCAGCTCGTCCTCCCCGGCCGTCTCGTCGTCGTCGCAGACCACCTCCGC
TTGATTAGTGTAGATTCGTCGATTACATCATTATATGTACGTAGTACGAGAGTGCATCAC
ATCAAAGTGCAGCTTGATTTTGGAGCTAGCTAGCTTAAATTAAGGGTTAATTACTGATTG
CTTCGTGATCGCACACACCACATTTGCTGTTTTGTTTGTAAAAAAGATAATAAAATACAT
AAATATTAAGG

CDS

1239 bp

>Os02t0325600-01 Nitrate-inducible and autorepressible transcriptional repressor, Nitrogen response
ATGGAGGTGGACCACGCGGACCGCGACGGCGCGCGGCGCCGGTGCCGCGAGTACCTGCTC
GCGCTCGAGGAGGAGCGCCGCAAGATCCAGGTGTTCCAGCGGGAGCTCCCTCTCTGCTTC
GACCTCGTCACCCAGACTATCGAGGGGATGAGGAGCCAGATGGACGCCGCCGGCAGCGAG
GAGACGGTCAGCGACCAGGGCCCGCCGCCGGTGCTCGAGGAGTTCATCCCGCTCAAGCCC
AGCCTCTCGCTGTCCTCCTCCGAGGAGGAGAGCACCCACGCCGACGCCGCCAAGTCAGGC
AAGAAGGAGGAGGCCGAGACGTCGGAGAGGCATTCGTCGCCGCCGCCGCCGCCGCCGGAG
GCCAAGAAGGTGACGCCGGATTGGCTCCAGTCCGTGCAGCTCTGGAGCCAAGAAGAACCC
CAGCAGCCATCGTCTCCTAGCCCAACTCCTACCAAGGATTTACCGTGCAAGCCGGTGGCG
CTGAACGCCAGGAAGGCCGGCGGAGCGTTCCAGCCGTTCGAGAAGGAGAAGCGCGCCGAG
CTGCCGGCGTCGTCGACCACGGCCGCGGCGAGCTCGACCGTGGTCGGAGACAGCGGCGAC
AAGCCCACCGATGATGACACGGAGAAACACATGGAGACGGACAAGGACAACGACAAGGAC
GCCAAGGACAAGGACAAGGAAGGCCAGTCGCAGCCTCACCGGAAGCCTCGCCGGTGCTGG
GCGCCGGAGCTCCACCGCCGCTTCCTGCAAGCGCTGCAGCAGCTGGGCGGGTCCCATGTA
GCGACGCCCAAGCAGATCCGGGAGCTGATGAAGGTGGATGGCCTCACCAACGACGAGGTC
AAGAGCCATTTGCAGAAGTATCGTCTACACACGAGGAGGCCGAGCTCGACggggcagagc
agcgccgcagccggcgtccccgccccgcctgcgccgcagttcgtcgtcgtcgggagcatc
tgggtacccccgccggaatacgctgccgcggccgccgcacagcagcacgtgcagcttgcc
gccgccggcaataatgcgtccgggagcgccaaccccgtgtacgctccggtggcgatgctg
ccggcaggctTGCAGCCGCATTCGCATCGGAAGCAGCACCAGCAGCAGCAGCAAGGACAG
AGACATTCCGGGTCGGAAGGCCGGCGGAGCGGGGACGCCGGCGATGGCAGCTCGTCCTCC
CCGGCCGTCTCGTCGTCGTCGCAGACCACCTCCGCTTGA

Protein

413 aa

>Os02t0325600-01 Nitrate-inducible and autorepressible transcriptional repressor, Nitrogen response
MEVDHADRDGARRRCREYLLALEEERRKIQVFQRELPLCFDLVTQTIEGMRSQMDAAGSE
ETVSDQGPPPVLEEFIPLKPSLSLSSSEEESTHADAAKSGKKEEAETSERHSSPPPPPPE
AKKVTPDWLQSVQLWSQEEPQQPSSPSPTPTKDLPCKPVALNARKAGGAFQPFEKEKRAE
LPASSTTAAASSTVVGDSGDKPTDDDTEKHMETDKDNDKDAKDKDKEGQSQPHRKPRRCW
APELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPSSTGQS
SAAAGVPAPPAPQFVVVGSIWVPPPEYAAAAAAQQHVQLAAAGNNASGSANPVYAPVAML
PAGLQPHSHRKQHQQQQQGQRHSGSEGRRSGDAGDGSSSSPAVSSSSQTTSA*

5'UTR

chr02:13096088..13096352 (+ strand) : 265 bp

CDS

chr02:13096353..13096488 (+ strand) : 136 bp

chr02:13096575..13096894 (+ strand) : 320 bp

chr02:13097006..13097327 (+ strand) : 322 bp

chr02:13097460..13097536 (+ strand) : 77 bp

chr02:13097648..13098031 (+ strand) : 384 bp

3'UTR

chr02:13098032..13098218 (+ strand) : 187 bp

FASTA

>Os02t0325600-01 class=Sequence position=chr02:13096088..13098218 (+ strand)
CCGTCCGTTC GATTCGACGA CACCTTCATT TTTATTTTCT TCCTTGTGTA ATAAGAAGAC GACTAGTGGT AACAAAAAGA
TTCGCTCCCT ACGCGACGCC CCGACCCCGA TTCCCTTCGC TTCCTACTCC TTCCTCTTCC TTGTTCCTTC CTTCCTTCCT
CACCCCACGA ACGCGCACAC CAACCTTTCC CATCCCTAGC TGCTGCCCTT CCATCGGATC CACGGATCGA GACCTGGCAC
GGCGGCGGAG GACGGGCCGG CGGAGATGGA GGTGGACCAC GCGGACCGCG ACGGCGCGCG GCGCCGGTGC CGCGAGTACC
TGCTCGCGCT CGAGGAGGAG CGCCGCAAGA TCCAGGTGTT CCAGCGGGAG CTCCCTCTCT GCTTCGACCT CGTCACCCAG
AGTACGCGCG CGCCTCGCTC GCCACGCATT CTTCGCTCGA TCGCTGCGCG TTCGTGCGCG TGAGTGCTAA TTGTGATTGT
GGTGCAGCTA TCGAGGGGAT GAGGAGCCAG ATGGACGCCG CCGGCAGCGA GGAGACGGTC AGCGACCAGG GCCCGCCGCC
GGTGCTCGAG GAGTTCATCC CGCTCAAGCC CAGCCTCTCG CTGTCCTCCT CCGAGGAGGA GAGCACCCAC GCCGACGCCG
CCAAGTCAGG CAAGAAGGAG GAGGCCGAGA CGTCGGAGAG GCATTCGTCG CCGCCGCCGC CGCCGCCGGA GGCCAAGAAG
GTGACGCCGG ATTGGCTCCA GTCCGTGCAG CTCTGGAGCC AAGAAGAACC CCAGCAGCCA TCGTCTCCTA GCCCAACTCC
TACCAAGGTA ATTAATTAAT AGGTTAATTT ATCAGCAGAT GAAAATGTTT TCTTGCTAGT TTGCACTACT CTTGATCTAC
TTTTAGCTAA TGCGTCGATC TCTGATGAAC TCTGCCAGGA TTTACCGTGC AAGCCGGTGG CGCTGAACGC CAGGAAGGCC
GGCGGAGCGT TCCAGCCGTT CGAGAAGGAG AAGCGCGCCG AGCTGCCGGC GTCGTCGACC ACGGCCGCGG CGAGCTCGAC
CGTGGTCGGA GACAGCGGCG ACAAGCCCAC CGATGATGAC ACGGAGAAAC ACATGGAGAC GGACAAGGAC AACGACAAGG
ACGCCAAGGA CAAGGACAAG GAAGGCCAGT CGCAGCCTCA CCGGAAGCCT CGCCGGTGCT GGGCGCCGGA GCTCCACCGC
CGCTTCCTGC AAGCGCTGCA GCAGCTGGGC GGGTCCCATG GTTAGTGCCA TTTTTTCTCA GTGACAGCTC GACCGGACAA
ACCAAATTAC ATTATCCTAT ATCAACAAAC AGTACTGATT AATCTCGCTT GTACTAGTTA ATTACGAGCT AATTAGTCCC
GTGCTTATGC AGTAGCGACG CCCAAGCAGA TCCGGGAGCT GATGAAGGTG GATGGCCTCA CCAACGACGA GGTCAAGAGC
CATTTGCAGG TCAGCAATGG CGGACACTAC TTTGCCCTAA TTTAACTCTT AACACACGCG GATAACCTGT TTACTCCTCT
CGATCATGTC CTTAATTTGT GTTTCGCTTG GGGTTCACAG AAGTATCGTC TACACACGAG GAGGCCGAGC TCGACggggc
agagcagcgc cgcagccggc gtccccgccc cgcctgcgcc gcagttcgtc gtcgtcggga gcatctgggt acccccgccg
gaatacgctg ccgcggccgc cgcacagcag cacgtgcagc ttgccgccgc cggcaataat gcgtccggga gcgccaaccc
cgtgtacgct ccggtggcga tgctgccggc aggctTGCAG CCGCATTCGC ATCGGAAGCA GCACCAGCAG CAGCAGCAAG
GACAGAGACA TTCCGGGTCG GAAGGCCGGC GGAGCGGGGA CGCCGGCGAT GGCAGCTCGT CCTCCCCGGC CGTCTCGTCG
TCGTCGCAGA CCACCTCCGC TTGATTAGTG TAGATTCGTC GATTACATCA TTATATGTAC GTAGTACGAG AGTGCATCAC
ATCAAAGTGC AGCTTGATTT TGGAGCTAGC TAGCTTAAAT TAAGGGTTAA TTACTGATTG CTTCGTGATC GCACACACCA
CATTTGCTGT TTTGTTTGTA AAAAAGATAA TAAAATACAT AAATATTAAG G

Locus: Os02g0325600

Loading...

Locus: Os02g0325600

Loading...