Os02t0325600-02

Locus

Os02g0325600

Description

Similar to Phosphate starvation response regulator-like protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

NIGT1

CGSNL Gene Name

NITRATE-INDUCIBLE, GARP-TYPE TRANSCRIPTIONAL REPRESSOR 1

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

"Nitrate-Inducible, GARP-type Transcriptional Repressor 1"

Transcript Evidence

AK064355 (DDBJ, Best hit)

Protein Evidence

A3AJ08 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

Myb-like DNA-binding domain, SHAQKYF class (IPR006447)

Homeodomain-like (IPR009057)

Homeodomain-related (IPR012287)

Myb, DNA-binding (IPR014778)

Transcription regulator HTH, Myb-type, DNA-binding (IPR017930)

Full-length cDNA

002-108-B01 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0325600-02)

RiceXPro (AK064355)

Others

Oryzabase (20509)

KEGG (Os02t0325600-02)

Transcript

1572 bp

>Os02t0325600-02 Similar to Phosphate starvation response regulator-like protein.
CTTCCTACTCCTTCCTCTTCCTTGTTCCTTCCTTCCTTCCTCACCCCACGAACGCGCACA
CCAACCTTTCCCATCCCTAGCTGCTGCCCTTCCATCGGATCCACGGATCGAGACCTGGCA
CGGCGGCGGAGGACGGGCCGGCGGAGATGGAGGTGGACCACGCGGACCGCGACGGCGCGC
GGCGCCGGTGCCGCGAGTACCTGCTCGCGCTCGAGGAGGAGCGCCGCAAGATCCAGGTGT
TCCAGCGGGAGCTCCCTCTCTGCTTCGACCTCGTCACCCAGACTATCGAGGGGATGAGGA
GCCAGATGGACGCCGCCGGCAGCGAGGAGACGGTCAGCGACCAGGGCCCGCCGCCGGTGC
TCGAGGAGTTCATCCCGCTCAAGCCCAGCCTCTCGCTGTCCTCCTCCGAGGAGGAGAGCA
CCCACGCCGACGCCGCCAAGTCAGGCAAGAAGGAGGAGGCCGAGACGTCGGAGAGGCATT
CGTCGCCGCCGCCGCCGCCGCCGGAGGCCAAGAAGGTGACGCCGGATTGGCTCCAGTCCG
TGCAGCTCTGGAGCCAAGAAGAACCCCAGCAGCCATCGTCTCCTAGCCCAACTCCTACCA
AGGATTTACCGTGCAAGCCGGTGGCGCTGAACGCCAGGAAGGCCGGCGGAGCGTTCCAGC
CGTTCGAGAAGGAGAAGCGCGCCGAGCTGCCGGCGTCGTCGACCACGGCCGCGGCGAGCT
CGACCGTGGTCGGAGACAGCGGCGACAAGCCCACCGATGATGACACGGAGAAACACATGG
AGACGGACAAGGACAACGACAAGGACGCCAAGGACAAGGACAAGGAAGGCCAGTCGCAGC
CTCACCGGAAGCCTCGCCGGTGCTGGGCGCCGGAGCTCCACCGCCGCTTCCTGCAAGCGC
TGCAGCAGCTGGGCGGGTCCCATGTAGCGACGCCCAAGCAGATCCGGGAGCTGATGAAGG
TGGATGGCCTCACCAACGACGAGGTCAAGAGCCATTTGCAGAAGTATCGTCTACACACGA
GGAGGCCGAGCTCGACggggcagagcagcgccgcagccggcgtccccgccccgcctgcgc
cgcagttcgtcgtcgtcgggagcatctgggtacccccgccggaatacgctgccgcggccg
ccgcacagcagcacgtgcagcttgccgccgccggcaataatgcgtccgggagcgccaacc
ccgtgtacgctccggtggcgatgctgccggcaggctTGCAGCCGCATTCGCATCGGAAGC
AGCACCAGCAGCAGCAGCAAGGACAGAGACATTCCGGGTCGGAAGGCCGGCGGAGCGGGG
ACGCCGGCGATGGCAGCTCGTCCTCCCCGGCCGTCTCGTCGTCGTCGCAGACCACCTCCG
CTTGATTAGTGTAGATTCGTCGATTACATCATTATATGTACGTAGTACGAGAGTGCATCA
CATCAAAGTGCAGCTTGATTTTGGAGCTAGCTAGCTTAAATTAAGGGTTAATTACTGATT
GCTTCGTGATCGCACACACCACATTTGCTGTTTTGTTTGTAAAAAAGATAATAAAATACA
TAAATATTAAGG

CDS

1239 bp

>Os02t0325600-02 Similar to Phosphate starvation response regulator-like protein.
ATGGAGGTGGACCACGCGGACCGCGACGGCGCGCGGCGCCGGTGCCGCGAGTACCTGCTC
GCGCTCGAGGAGGAGCGCCGCAAGATCCAGGTGTTCCAGCGGGAGCTCCCTCTCTGCTTC
GACCTCGTCACCCAGACTATCGAGGGGATGAGGAGCCAGATGGACGCCGCCGGCAGCGAG
GAGACGGTCAGCGACCAGGGCCCGCCGCCGGTGCTCGAGGAGTTCATCCCGCTCAAGCCC
AGCCTCTCGCTGTCCTCCTCCGAGGAGGAGAGCACCCACGCCGACGCCGCCAAGTCAGGC
AAGAAGGAGGAGGCCGAGACGTCGGAGAGGCATTCGTCGCCGCCGCCGCCGCCGCCGGAG
GCCAAGAAGGTGACGCCGGATTGGCTCCAGTCCGTGCAGCTCTGGAGCCAAGAAGAACCC
CAGCAGCCATCGTCTCCTAGCCCAACTCCTACCAAGGATTTACCGTGCAAGCCGGTGGCG
CTGAACGCCAGGAAGGCCGGCGGAGCGTTCCAGCCGTTCGAGAAGGAGAAGCGCGCCGAG
CTGCCGGCGTCGTCGACCACGGCCGCGGCGAGCTCGACCGTGGTCGGAGACAGCGGCGAC
AAGCCCACCGATGATGACACGGAGAAACACATGGAGACGGACAAGGACAACGACAAGGAC
GCCAAGGACAAGGACAAGGAAGGCCAGTCGCAGCCTCACCGGAAGCCTCGCCGGTGCTGG
GCGCCGGAGCTCCACCGCCGCTTCCTGCAAGCGCTGCAGCAGCTGGGCGGGTCCCATGTA
GCGACGCCCAAGCAGATCCGGGAGCTGATGAAGGTGGATGGCCTCACCAACGACGAGGTC
AAGAGCCATTTGCAGAAGTATCGTCTACACACGAGGAGGCCGAGCTCGACggggcagagc
agcgccgcagccggcgtccccgccccgcctgcgccgcagttcgtcgtcgtcgggagcatc
tgggtacccccgccggaatacgctgccgcggccgccgcacagcagcacgtgcagcttgcc
gccgccggcaataatgcgtccgggagcgccaaccccgtgtacgctccggtggcgatgctg
ccggcaggctTGCAGCCGCATTCGCATCGGAAGCAGCACCAGCAGCAGCAGCAAGGACAG
AGACATTCCGGGTCGGAAGGCCGGCGGAGCGGGGACGCCGGCGATGGCAGCTCGTCCTCC
CCGGCCGTCTCGTCGTCGTCGCAGACCACCTCCGCTTGA

Protein

413 aa

>Os02t0325600-02 Similar to Phosphate starvation response regulator-like protein.
MEVDHADRDGARRRCREYLLALEEERRKIQVFQRELPLCFDLVTQTIEGMRSQMDAAGSE
ETVSDQGPPPVLEEFIPLKPSLSLSSSEEESTHADAAKSGKKEEAETSERHSSPPPPPPE
AKKVTPDWLQSVQLWSQEEPQQPSSPSPTPTKDLPCKPVALNARKAGGAFQPFEKEKRAE
LPASSTTAAASSTVVGDSGDKPTDDDTEKHMETDKDNDKDAKDKDKEGQSQPHRKPRRCW
APELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPSSTGQS
SAAAGVPAPPAPQFVVVGSIWVPPPEYAAAAAAQQHVQLAAAGNNASGSANPVYAPVAML
PAGLQPHSHRKQHQQQQQGQRHSGSEGRRSGDAGDGSSSSPAVSSSSQTTSA*

5'UTR

chr02:13096207..13096352 (+ strand) : 146 bp

CDS

chr02:13096353..13096488 (+ strand) : 136 bp

chr02:13096575..13096894 (+ strand) : 320 bp

chr02:13097006..13097327 (+ strand) : 322 bp

chr02:13097460..13097536 (+ strand) : 77 bp

chr02:13097648..13098031 (+ strand) : 384 bp

3'UTR

chr02:13098032..13098218 (+ strand) : 187 bp

FASTA

>Os02t0325600-02 class=Sequence position=chr02:13096207..13098218 (+ strand)
CTTCCTACTC CTTCCTCTTC CTTGTTCCTT CCTTCCTTCC TCACCCCACG AACGCGCACA CCAACCTTTC CCATCCCTAG
CTGCTGCCCT TCCATCGGAT CCACGGATCG AGACCTGGCA CGGCGGCGGA GGACGGGCCG GCGGAGATGG AGGTGGACCA
CGCGGACCGC GACGGCGCGC GGCGCCGGTG CCGCGAGTAC CTGCTCGCGC TCGAGGAGGA GCGCCGCAAG ATCCAGGTGT
TCCAGCGGGA GCTCCCTCTC TGCTTCGACC TCGTCACCCA GAGTACGCGC GCGCCTCGCT CGCCACGCAT TCTTCGCTCG
ATCGCTGCGC GTTCGTGCGC GTGAGTGCTA ATTGTGATTG TGGTGCAGCT ATCGAGGGGA TGAGGAGCCA GATGGACGCC
GCCGGCAGCG AGGAGACGGT CAGCGACCAG GGCCCGCCGC CGGTGCTCGA GGAGTTCATC CCGCTCAAGC CCAGCCTCTC
GCTGTCCTCC TCCGAGGAGG AGAGCACCCA CGCCGACGCC GCCAAGTCAG GCAAGAAGGA GGAGGCCGAG ACGTCGGAGA
GGCATTCGTC GCCGCCGCCG CCGCCGCCGG AGGCCAAGAA GGTGACGCCG GATTGGCTCC AGTCCGTGCA GCTCTGGAGC
CAAGAAGAAC CCCAGCAGCC ATCGTCTCCT AGCCCAACTC CTACCAAGGT AATTAATTAA TAGGTTAATT TATCAGCAGA
TGAAAATGTT TTCTTGCTAG TTTGCACTAC TCTTGATCTA CTTTTAGCTA ATGCGTCGAT CTCTGATGAA CTCTGCCAGG
ATTTACCGTG CAAGCCGGTG GCGCTGAACG CCAGGAAGGC CGGCGGAGCG TTCCAGCCGT TCGAGAAGGA GAAGCGCGCC
GAGCTGCCGG CGTCGTCGAC CACGGCCGCG GCGAGCTCGA CCGTGGTCGG AGACAGCGGC GACAAGCCCA CCGATGATGA
CACGGAGAAA CACATGGAGA CGGACAAGGA CAACGACAAG GACGCCAAGG ACAAGGACAA GGAAGGCCAG TCGCAGCCTC
ACCGGAAGCC TCGCCGGTGC TGGGCGCCGG AGCTCCACCG CCGCTTCCTG CAAGCGCTGC AGCAGCTGGG CGGGTCCCAT
GGTTAGTGCC ATTTTTTCTC AGTGACAGCT CGACCGGACA AACCAAATTA CATTATCCTA TATCAACAAA CAGTACTGAT
TAATCTCGCT TGTACTAGTT AATTACGAGC TAATTAGTCC CGTGCTTATG CAGTAGCGAC GCCCAAGCAG ATCCGGGAGC
TGATGAAGGT GGATGGCCTC ACCAACGACG AGGTCAAGAG CCATTTGCAG GTCAGCAATG GCGGACACTA CTTTGCCCTA
ATTTAACTCT TAACACACGC GGATAACCTG TTTACTCCTC TCGATCATGT CCTTAATTTG TGTTTCGCTT GGGGTTCACA
GAAGTATCGT CTACACACGA GGAGGCCGAG CTCGACgggg cagagcagcg ccgcagccgg cgtccccgcc ccgcctgcgc
cgcagttcgt cgtcgtcggg agcatctggg tacccccgcc ggaatacgct gccgcggccg ccgcacagca gcacgtgcag
cttgccgccg ccggcaataa tgcgtccggg agcgccaacc ccgtgtacgc tccggtggcg atgctgccgg caggctTGCA
GCCGCATTCG CATCGGAAGC AGCACCAGCA GCAGCAGCAA GGACAGAGAC ATTCCGGGTC GGAAGGCCGG CGGAGCGGGG
ACGCCGGCGA TGGCAGCTCG TCCTCCCCGG CCGTCTCGTC GTCGTCGCAG ACCACCTCCG CTTGATTAGT GTAGATTCGT
CGATTACATC ATTATATGTA CGTAGTACGA GAGTGCATCA CATCAAAGTG CAGCTTGATT TTGGAGCTAG CTAGCTTAAA
TTAAGGGTTA ATTACTGATT GCTTCGTGAT CGCACACACC ACATTTGCTG TTTTGTTTGT AAAAAAGATA ATAAAATACA
TAAATATTAA GG

Locus: Os02g0325600

Loading...

Locus: Os02g0325600

Loading...